SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012484 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012484
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-38
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 473-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000785
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 268-334
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000136
Family VWC domain 0.0097
Further Details:      
 
Domain Number 4 Region: 683-755
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000023
Family VWC domain 0.022
Further Details:      
 
Domain Number 5 Region: 435-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000315
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012484
Domain Number - Region: 335-393
Classification Level Classification E-value
Superfamily FnI-like domain 0.000126
Family VWC domain 0.017
Further Details:      
 
Domain Number - Region: 390-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000812
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 766-803
Classification Level Classification E-value
Superfamily FnI-like domain 0.0335
Family VWC domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012484   Gene: ENSTNIG00000009609   Transcript: ENSTNIT00000012675
Sequence length 811
Comment pep:novel chromosome:TETRAODON8:5:11853142:11960112:-1 gene:ENSTNIG00000009609 transcript:ENSTNIT00000012675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQMDIYFTLFSLFFFTKPASAFGSDQDYQLDIISELDLANATYGITQVAGLHNNSKAFLF
RDVGRAVHAPAHITERVVQLFKSKSEFTFLASIQQKSSTSGVIFSIHESEHSSYFELESS
GVREEIRYHYRFKGKPRSESFPYRLADGLWHKIALTISASHLLLHVDCNRIYERVIDPPQ
MEITPGSGVWLGQHSHKHGLFKGVIQDVKLIFAPNGYITQCPNLNRTCPTCSDFLSLVQG
IMDLQELLAKMTLKLNYAESRLTQLEGCHCERTCSANGLVYRDKELWVEPENCRNCACKN
GVVECRRIFCPPANCSEDSLPVHVDGSCCKKCRPKCTYRGQIFSEGQRLLSRSCRECKNA
LMLKVTETCPELNCTLAEQILPDGRCCNVCRGYDFCAEGLICGENSECKNRNTKAECECR
SGYASIHGDSTYCEDIDECATQMHYCQSNTVCVNLPGSLRCDCLPGFIRVDEYSCSEHDE
CASGQNLCDENAICTNTIRGHLCTCKPGYVGNGTICRAFCEDGCRSGGTCVSPNTCVCPS
GFTGPRCETDIDECAEGLIQCHDHSRCVNLPGWYHCECRSGFQDNGTYLLDGSSCIDVDE
CKLQTHTCWNHSVCVNLPGSYDCVCTSGPGCSGDCQQDKGIRRNGEDWKPSFDRCALCSC
KDGHTYCRRRACDCGDPHQDLFCCPGCDNRPSSQCLDQSGRTLYPSGASWLYGCQQCRCL
EGEVDCWSLVCPTLMCEYTAVAEGECCPRCVADPCLADNLSYDIRQTCQDPAGIMRLSGD
TWHMPNSPCTSCKCKNGNVCCSVDLDCLQNN
Download sequence
Identical sequences H3CW50
99883.ENSTNIP00000012484 ENSTNIP00000012484 ENSTNIP00000012484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]