SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012520 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012520
Domain Number 1 Region: 864-1074
Classification Level Classification E-value
Superfamily vWA-like 2.07e-59
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 5-191
Classification Level Classification E-value
Superfamily vWA-like 1.05e-57
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1093-1297
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-32
Family Glycosyl hydrolases family 16 0.078
Further Details:      
 
Domain Number 4 Region: 392-552
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-23
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 686-773
Classification Level Classification E-value
Superfamily Fibronectin type III 4.41e-20
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 6 Region: 210-296
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-17
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 300-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000238
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 593-672
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000121
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 9 Region: 805-872
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000334
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012520   Gene: ENSTNIG00000009644   Transcript: ENSTNIT00000012711
Sequence length 1634
Comment pep:novel chromosome:TETRAODON8:8:5495838:5532385:-1 gene:ENSTNIG00000009644 transcript:ENSTNIT00000012711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVCRTEAIADIVILVDGSWSIGRLNFRLVRMFLENLVNAFDVGIDKTRIGLAQYSGDPR
IEWHLNAYSTKDAVIDAVRNLPYKGGNTLTGLALNFILENCFKPESGSREGLPKIGILIT
DGKSQDDVVPPAESLRNAGIELFAIGVKNADENELQSIASPPEDTHVYNVADFSVMNSIV
EALTRTVCEQVVQQDKEIKQISEHVPETVGAPHELVTSEVTARNFRVSWSPAPGNVEKYR
VVYYAARGEEPHEAVVDGSETSVVLDHLSSLTEYQLAVFAVYATEASEALRGSETTLALP
SVTGLQLLDVTHSTMKVTWDRVEGASGYLLLYGPLIEDGQLNEKELKLSNAVTELELQAL
NPHTEYTVTVYAMYGDETSDPMTTQETTLPLNPPSNLQFSDITHKSAHISWDSAFPAAKG
YRIVWVKTDGLVMEELIVGNVNSYDLSNLMSLTEYSVAVSAVYDEGQSEPLTDGFTTTPV
PGPLNLRSTNVSSDSFQVIWDHSANDIVLYRLSWAPFTGGDTKEVVLSGSNNRYVLTGLN
PSTEYEVLLTAVFRDESESDTISVIETTYSTCTDTCKGQASSISPFTVILKKAVRNLQLT
DETTESLKASWEMNDPYVESYRISYFGNNHKEESVSIQFLVPGGQRRAVLPSLLSDTQYK
VTVTPVYVDGQDGISASAFSATLPLLSPGNLRVSEEWYTRFKVTWDPPQSPVLGYRIVYQ
PVYVPEPLLETTVNEDVNSMVLLNLLPGTEYNVQLTASYPMGESEPLLKTAKTWKLGITQ
AQGEYVKNSSSCSVLKVHRHCLVCLYVVLKDMQDGQKQEVTLGGGASRQCFYDLTPSSQY
QISVCTQMQETEGPSVSITDMTLPAPTQAPTEAPTTEPPPTIPPPKEVCKEAKADLVFLV
DGSWSIGDENFMKITRFLHSTVGSLDLIGTDGTQVAIAQFSDDARTEFQLSSHSNKEALL
EAIQKISYKGGNTKTGRAIKHVKESIFSLEAGARRGVPKVLVVLTDGRSQDDVNKVSKEM
QMDGYIIFAIGFADADYGELVNIASKPSDRHVFFVDDLDAVKKIEEQLITFVCEAATATC
PSVLMSGNTIAGFRMMDKFGLVEKEYSTIPGVSLEPGSFNSFPSYRLHRDALVSQPTKYL
HPEPLPSDYTISIMLRLLPETPQEPFALWEILNKRNEPLVGLILDNSGKTLTFFNHDFKG
EFQTVTFEGNEIKKLFHGSFHKLHVTISKTSVKAVLDCSAVGEKSVYAAGNITTDGVEIL
GRMVRSRGRRDSSAPFQLQMFDIICSTSWARRDKCCELPALRVEAQCPPLPHACTCSQDS
KGPPGPSGPPGGPGTRGARGDRGEPGLTGPQGPVGDRGSAGPPGPPGPQGPSGLSIQGPP
GIAGEKGERGANGPPGQMGLPGGPGTPGRDGPPGIRGLPGNIGPQGRQGPPGPLGAPGAP
GVPGPSGSAGSPGDQGIPGPAGAKGDKGERGDVQSQAAVRAIARQVCEQLIQSHLSRYNS
ILNQIPVQSSASVRTVPGPPGEPGRTGPPGPPGEQGPTGRPGFPGTNGQSGRPGERGLPG
EKGERGNPGVGSQGPRGPPGPPGPAGEGRAGSQGPPGRPGNSGTPGRPGNQCAPGQTGPP
GYCDQNSCLGYTVG
Download sequence
Identical sequences H3CW86
ENSTNIP00000012520 99883.ENSTNIP00000012520 ENSTNIP00000012520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]