SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012578 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012578
Domain Number 1 Region: 106-147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012578   Gene: ENSTNIG00000009697   Transcript: ENSTNIT00000012769
Sequence length 351
Comment pep:novel chromosome:TETRAODON8:14:8354333:8357769:-1 gene:ENSTNIG00000009697 transcript:ENSTNIT00000012769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FILDYKNFPDLANADISSQNPNIQVTIEVVDDPQMEVEMDLAKENEWLPSSSSSPSSTVD
WLGEGEEDYSIDYGSEEHILSGVGGDWDTHWNEGWDPVQSYYEKETDEWTPWSPCSVTCG
HGEKKRTRSCGYSCTLTEASKCDLEPCPGEIPFAFQHFKTQTYAKESLWMENGTEPFGTD
VDSCEKWLNCKSEFLQSYLHQVMSELPSCPCSYPSEVAYTVVSLYDETRARQFRWRDASS
PKERLDIYKPSARNCIRSTLSSDSSTLAAQHCCYSDRGQLITRGKGAGTPNLISTEFSPE
LHFKVDVLPWILCKGDWSRFHAVRPPNNGLKCPENPHEDVFMNELEEAREY
Download sequence
Identical sequences H3CWE4
99883.ENSTNIP00000012578 ENSTNIP00000012578 ENSTNIP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]