SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012581 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012581
Domain Number 1 Region: 875-1056
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-37
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 681-872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-32
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 3 Region: 22-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 1089-1229,1258-1300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-30
Family Laminin G-like module 0.00000213
Further Details:      
 
Domain Number 5 Region: 220-259,289-433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000336
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 6 Region: 584-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000245
Family Laminin G-like module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012581   Gene: ENSTNIG00000009700   Transcript: ENSTNIT00000012772
Sequence length 1508
Comment pep:novel chromosome:TETRAODON8:14:8449052:8625832:1 gene:ENSTNIG00000009700 transcript:ENSTNIT00000012772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSTMCPNSLPVCVLLLSTLLGWSAGLNFTGSEGQWARYIRWDASSRSDLMFQFKTSEPEG
MLLYFDDGGFCDFLLLTLSEGRLQLRVSIDCAETTITSDKMVNDGRWHFAAVNRHNLRTG
LAVDGQSKTGEVRPQRQFMKIVSDLFLGGLPGDIRTSAITLPSVRELPPFKGIITDLSYG
SKQLPMLINSQKVRLEMIGLCTENPCENGGICSLADGETYCDCSKTGYVGRYCTEVFASS
FKGLAHLKAEQEMNIKGKNPYHLICKSQAAFCALNSDLSEKICEGKSSRVNIFFRACRRE
RLMFHLRRAVSCVGLVIENGLRTLKVHLRSIVMEAVTNQPLQNQNTAAWNSSRIIRLGKQ
SGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN
NFMGCLKEVRRTRIIQRKHLSVYNVQQQPKAKIWHCFRFKCSSYAALLDRDILFHYPITK
TLLLLCPHDCKCRGSARRNLPCTKPHLLILYGKSKPKLHLHSHHPQIFQVIYFTEGCASS
HLLYLYDLKTFPNTQKIKEDQIQQNQGIRWNSLEDDNCDNRAERIISVNTRRTPFTASGE
NEILDLEGDLYLGGLPDNRVGLVLPTELWTAMLNYGYVGCVRDLFIDGRSKDIRQIAQSQ
NMTGIKSSCNKLTGKQCDSNPCKNNGLCKEGWNRFICDCTGTGYWDSSCEKEASILSYDG
SMYMKVVIPSVMHTEAEDVSLRFMFQRAFGLLMAATSRESADTLRLELDSGRVKLTVNLD
CVRINCNTSKGPEVLYAGQKLNDNEWHSVRVSRRGKNFKLIVDDDMAEVGQMAGDHTRLE
FNNVETGILTERRFVSSAPSSFIGHLQSLKFNGMQYIDMCKNGDIDFCELNAHFGMRFII
ADPVTFKTKGSYLGLATLQAYTTMHLFFQFKTTSPDGFLFFNSGDGNDFIAVELVKGFIH
YVFDLGNGPSLLKGNSDNPLNDNQWHNVVITRDASNTHTLKVDTKSVTQNVNGAKNLDLK
GDLFVGGLGPNMYQNLPKLVVSREGFQGCLASVDLNGRLPDLISDALFRSGQIERGCEGP
STTCQEDSCANMGVCIQQWENFTCDCSMTSYTGTYCNDPGTTYIFGKGGGLITYTWPYNE
RPSTRTDRLAVGFSTTIKDGILVRIDSAPRLGDYIMLHIEQGKVCVTFNIGTVDISVKET
STPINDGKYHLVRFTRNGGNATLQVDNWPINEHFPTGNSEIERYQMANKKIPFKYTRPVE
DWLQEKGRQLTIFNTQATITIGGNDRKRPYQGQLSGLYYNGLKVLNMAAEGHVNIKVNGS
VRLVGDVPNSRGGARTTTSVPPEMSTTFIETTTTLSTTTTRKQRSPPTIQPVKYTTDDIV
SSAECSSDDEDLEECDSGHAGFANKPLCVVRRVPPGASEVIRESSSTTGMVVGIVSAAAL
CILILLYAMYKYRNRDEGSYQVDETRNYISNSAQTNGAVVKDKTPSSSSAKGNANSKRPK
DKDKEYYV
Download sequence
Identical sequences H3CWE7
99883.ENSTNIP00000012581 ENSTNIP00000012581 ENSTNIP00000012581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]