SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012664 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012664
Domain Number 1 Region: 61-255
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-80
Family Sec7 domain 0.00000000949
Further Details:      
 
Domain Number 2 Region: 264-378
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-32
Family Pleckstrin-homology domain (PH domain) 0.00000215
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012664
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012664   Gene: ENSTNIG00000009776   Transcript: ENSTNIT00000012855
Sequence length 400
Comment pep:novel chromosome:TETRAODON8:3:10740085:10747221:1 gene:ENSTNIG00000009776 transcript:ENSTNIT00000012855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLFRFVSSTVPDDLTPEEQQELENIRRRKQELLEDIQRLKDEIAEVKSEIENLGSTEERK
NMQRSKQVNMGRKKFNMDPKKGIQFMIENDLLKNTSDDIAQFLHKGEGLNKTAIGDYLGE
RDEFNIQILHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPG
VFQSTADTCYILSFAIIMLNTSLHNPNVKDKPTVERFISMNRGINDGGDLPEDLLRNLYE
SIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSVKEVEDKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRIS
AQTAEEKEEWMNSIKAAISRDPFYEMLAARKKKVSSMKRH
Download sequence
Identical sequences H3CWN0
ENSTNIP00000012664 ENSTNIP00000012664 99883.ENSTNIP00000012664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]