SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012673 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012673
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 9.8e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000765
Further Details:      
 
Domain Number 2 Region: 64-182
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-24
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012673   Gene: ENSTNIG00000009786   Transcript: ENSTNIT00000012865
Sequence length 433
Comment pep:novel chromosome:TETRAODON8:3:10886480:10887781:1 gene:ENSTNIG00000009786 transcript:ENSTNIT00000012865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GERADHRYSIVSSEEDGMKLAAVAVPNGYGNGNVDKGHAERQHQSRFVRKGAHCNVQFIN
MSEKGQRYLADIFTTCVDIRWRWMLLVFCLSFLLSWLFFGLVFWMVALSYGDLDSKTQKC
VSNVDSFTAAFLFSVETQTTIGYGYRYVTEECPIAVFMVVFQSIVGCIIDAFIIGAVMAK
MAKPKKRNETLVFSYYATVAMRDSKLCLMWRVGNLRKSHLVEAHVRAQLLKSRTTAEGEY
IPLDQVDIDVGFDSGLDRIFLVSPITIVHEIDEDSPFYEMSKEDLQTSEFEIVVILEGMV
EATAMTTQCRSSYVAGEILWGHRFEPVLFEEKNYYKVDYSRFDNTYEVPSTPVCSARELA
EKMSNPSSSRNSFCYENEVALEKVELEDEESGAARGDEVGAFEDTAAGVVLDSECNLDSV
SLESRPLTAESEI
Download sequence
Identical sequences H3CWN9
99883.ENSTNIP00000012673 ENSTNIP00000012673 ENSTNIP00000012673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]