SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012812 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012812
Domain Number 1 Region: 834-1133
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-117
Family BEACH domain 0.000000000115
Further Details:      
 
Domain Number 2 Region: 1245-1498
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-31
Family WD40-repeat 0.0071
Further Details:      
 
Domain Number 3 Region: 722-829
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-29
Family PreBEACH PH-like domain 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012812   Gene: ENSTNIG00000009920   Transcript: ENSTNIT00000013004
Sequence length 1511
Comment pep:novel chromosome:TETRAODON8:7:3281244:3298316:1 gene:ENSTNIG00000009920 transcript:ENSTNIT00000013004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSTELENIEATQGMSSETAVTFLS
RLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGKS
SLTSSKSQDSLYSASTTSKVTHVRTKTQTLQDPDRLLQDVDINRLRAVVFRDVDDSKQAQ
FLALAVVYFISVLMVSKYRDILEPQREIGRSTSLSGRSIRHEINSPTSTEHPSTAFSDKQ
TPTPVDDSPRAGLPHTDSGIGEEGHVAGSLNGSEMGLGLGLGLVGRDLSDVTRSQESLLD
SPHNPSATPNSSQAPPSSITSISQTNKGINVKEILKSLVAAPVDGGELGQEAGPTPYHPD
PALKTHPMLPMQFHSFDSNIFIFCLKAATRRSSMNTPIRYWITGVESGATDSASSSSSSS
SSFVNGATSKNLPAVQTVAPMPEDTMENMSITTKLERALEKVAPLLREIFVDFAPFLSRT
LLGSHGQELLIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLC
HAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHR
DHVTANQLKQKILNILTNKHGAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVRNPFGSTHA
DISLKALEEYGTEEEEEGLKPKKTFRSQSVVAQNPEAELMLEGDDDTVSLLQEKEIDNLA
GPVVLSTPAQLVAPVVVARGTLSITTTEIYFEVDEEDSAFKNTDAKVLAYTEGLHGKWMF
SEIRAVFSRRYLLQNTGLEVFMANRTSVMFNFPDQATVKRVVYSLPRVGVGTSYGLPQAR
RISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYDS
EELDLTLPGNFRDLSKPIGALNPKRAAFYAERYETWDDDSAPSHHYTTLYSTAHSTLMWM
LRIEPFSTFFLNANDNKFDNPERAFSGIGRSWRNCQRDTADVKELIPEFYYLPEMFVNSN
EYELGVRDDGVPVCDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGP
EAVRALNVFNFLSYEGAVNLDTVDAAQRELIETQIQACGQVPSQLLIEPHPPRSSAMHLS
PLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVNRWHNTVGL
RGAPGYSLEQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINTHCFVVTADNRYILAC
GFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSG
RHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLR
ALEGPELCLRPRLISVSSEGHCIIYYERGRFCNFSINGKLLAQMEVNDSTRAVLLSSDGQ
NLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDF
NRWHYEHQNRY
Download sequence
Identical sequences H3CX27
ENSTNIP00000012812 99883.ENSTNIP00000012812 ENSTNIP00000012812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]