SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012827 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012827
Domain Number 1 Region: 490-748
Classification Level Classification E-value
Superfamily NHL repeat 3.14e-46
Family NHL repeat 0.00000973
Further Details:      
 
Domain Number 2 Region: 329-425
Classification Level Classification E-value
Superfamily E set domains 6.67e-19
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 115-175
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000022
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 20-99
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000663
Family RING finger domain, C3HC4 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012827   Gene: ENSTNIG00000009935   Transcript: ENSTNIT00000013019
Sequence length 750
Comment pep:novel chromosome:TETRAODON8:7:3521219:3527409:-1 gene:ENSTNIG00000009935 transcript:ENSTNIT00000013019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMAKHEAGRTSPVVRQIDKQFLVCSICLDHYRTPKVLPCLHTFCESCLQNYIPPESLTL
SCPVCRQTSILPEKGVCALQNNFFITNLMEVLQRDSECPRPEACSVLESVSAAAAGKPLC
CPNHEGKVMEFYCESCETAMCLDCTEGEHREHVTVPLRDVVEQHKAVLKTQLDAIRGRLP
QLTAAIELVGEISRQLNERKSEAVAEITGTFEELERALHQRKTALITDLENICTTKQKVL
QAQLSALLQGKEHIQNSCSFTEQALSHGSATEVLLVQKQMSERVTALARHDFPERPHQNA
HLDCLVETDGLRRSIQNLGVLVTTAAVAHTSVATGEGLRHAATGQHHTITVTTKDKDGEL
VRTGNAVLKAEITLTDGSRGAETEVSDNKNGTYEVGYTLHSEGEYSFSLMLYGQPVRGSP
FRLRAVKPSDVPQSPDDVKRRVKSPSGTGGHIRQKAVRRPSSMYSTTKKKENPIEDELIY
RVGSRGREKGEFTNLQGISASSNGRVVVADSNNQCIQIFSNDGQFKMRFGIRGRSPGQLQ
RPTGVTVDMNGDIVVADYDNRWVSIFSAEGKFKNKIGAGRLMGPKGVAVDKNGHIITVDN
KACCVFIFQSNGKLVTKFGGRGTADRQFAGPHFVAVNNKNEIIVTDFHNHSVKVYNADGE
FLFKFGSHGEGNGQFNAPTGVAVDANGNIIVADWGNSRIQVFDSTGSFLSYINTSADPLY
GPQGLALTSDGHVAVADSGNHCFKVYRYLQ
Download sequence
Identical sequences H3CX42
99883.ENSTNIP00000012827 ENSTNIP00000012827 ENSTNIP00000012827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]