SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012846 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012846
Domain Number 1 Region: 3089-3204
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-32
Family Cadherin 0.00061
Further Details:      
 
Domain Number 2 Region: 3199-3303
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-31
Family Cadherin 0.00086
Further Details:      
 
Domain Number 3 Region: 788-890
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 2145-2250
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 885-1003
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-27
Family Cadherin 0.0008
Further Details:      
 
Domain Number 6 Region: 2666-2781
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 318-438
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-26
Family Cadherin 0.0028
Further Details:      
 
Domain Number 8 Region: 2990-3101
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 3700-3899
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.67e-26
Family Laminin G-like module 0.0093
Further Details:      
 
Domain Number 10 Region: 997-1103
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 11 Region: 1417-1518
Classification Level Classification E-value
Superfamily Cadherin-like 8.77e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 576-680
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 13 Region: 1311-1415
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 8-129
Classification Level Classification E-value
Superfamily Cadherin-like 2e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 2888-2996
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 16 Region: 682-793
Classification Level Classification E-value
Superfamily Cadherin-like 5e-22
Family Cadherin 0.00084
Further Details:      
 
Domain Number 17 Region: 1620-1740
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 18 Region: 1941-2043
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 19 Region: 2354-2464
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 20 Region: 1524-1626
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 21 Region: 2458-2563
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-20
Family Cadherin 0.0048
Further Details:      
 
Domain Number 22 Region: 2044-2151
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 23 Region: 2783-2894
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 24 Region: 3299-3420
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 25 Region: 1105-1211
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-18
Family Cadherin 0.0034
Further Details:      
 
Domain Number 26 Region: 2252-2351
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 429-529
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000742
Family Cadherin 0.0025
Further Details:      
 
Domain Number 28 Region: 1846-1948
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000104
Family Cadherin 0.0067
Further Details:      
 
Domain Number 29 Region: 1218-1317
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000314
Family Cadherin 0.013
Further Details:      
 
Domain Number 30 Region: 2569-2678
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000443
Family Cadherin 0.0051
Further Details:      
 
Domain Number 31 Region: 1728-1839
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000171
Family Cadherin 0.0051
Further Details:      
 
Domain Number 32 Region: 3904-3946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000475
Family EGF-type module 0.021
Further Details:      
 
Domain Number 33 Region: 4009-4051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000965
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 34 Region: 3407-3506
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000589
Family Cadherin 0.01
Further Details:      
 
Domain Number 35 Region: 3938-3974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.029
Further Details:      
 
Domain Number 36 Region: 237-330
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000103
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012846
Domain Number - Region: 133-226
Classification Level Classification E-value
Superfamily Cadherin-like 0.00013
Family Cadherin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012846   Gene: ENSTNIG00000009953   Transcript: ENSTNIT00000013038
Sequence length 4272
Comment pep:novel chromosome:TETRAODON8:7:3818212:3860727:1 gene:ENSTNIG00000009953 transcript:ENSTNIT00000013038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALATVYIRVLDTNDLRPLFSPTSYSFIVPESAPLGASIGRVTATDADMGSNGEFYYFFK
NKVNLFAVHPTSGVITLTGRPRMDKEDRFELEVQVVDRGMKLYGNNGISSTAKLLLTVQR
VNQFSPVLSAVAVIPSVSGKDAVYAIVNVEDKDEGVAGDIEWVSIIEGDPFEQFVVDRSP
VGNEYRVKTSDLVDWEAFPYGCNLTFQAKDRGIPPRFSNTQVVQLLVTKPDPVLAKFEKD
VYVFKLSEIAPPGTIVEVVKISPLPPSINYSLSDQKCFDINPLTGVLMTKCHLTRISQDF
MEMEVVDIISQQRATIQITIEDANDNSPVFSKPFYDISINESLPLGTVVLVASAVDDDKG
ENGFVTHTIAGEMSLPFSIDQNTGEIRVTQDLDFESSDDIYSFAVRASDWGAPYRRESEV
NVTIRLINVNDNPPLLEMVSCKGMISRDFPVSQTIVTLSAVDIDELGMVKYKVVSGNELD
YFDLNPDTGALSLKRSLEEVSLKNGLFNLKIAATDGELFSDPTYVNVSVVRGRMPPMGFN
CKETRVAQMLAEKMLSKASSMARARPDEIFTDIFSINKHAPQFEALPTSILVREDLPVGA
SVFQVRARDGDTGFNGRVLFSISDGNKLNSFNINTENGLITVFQQLDRENLDRYFLNITI
YDQGVPQMSSWRLLTVIIEDANDNDPQFYQDSFSALILENSAIGLEVISITAFDRDMGQN
GQLSYKMLNNIQQFGIDSETGSVFVASHLDRETTPMFTLKIEVRDKAERGSRRSSVTTLS
VIIDDVNDCAPAFIPNSYSARVPEDLPPGTVITWVQAQDPDIGPSGQVQYALINDFNSTF
EIDAVTGVLRLRKELDFEKQQFFNLTVIAEDRGVPSFISQTFVEVEVVDVNENLYAPYFN
DFAVRGTVKENSRVGTSVLTVSAKDDDKGRDGVLRYSIKGGNGLGTFTIDEDTGVIYTAG
ILDCESKDAYWLTVYATDRGVTPLSASVEVFIQVEDVNDNAPLTSDPIYHPVVMENSPKD
VSVIRIQAQDPDLTSTPSRLSYRITAGNPQNFFAINPRTGLITTTTRKLDREQQSEHFLE
VTVIDGPVTTRQSTVWVMVHVEDENDNPPTFPEVTYRISLTERDRNKRGEPVYRVFAYDR
DLGANGNITYSIVDGNEDEKFIIDPRTAMVSSKKMVTAGSYDILTIKAEDGGDPPLWTTV
KLHVEWIRKPVPSPLPLLFTQRSYNFSVLETAAVAQPVGVVAITQSTTPVWFNIIARSFD
MQFDLQVGVGTLIVAKPLDAEVQSVYNMTVQVTDGTNFATAQVFIRVQDGNDNPPVFSQP
AYDVSVSEDIPVDMELVRVRASDMDERARLSYSIYGSVDPASMRLFRVNPGTGIVYTTDR
LDYEARTQHILTIMVKDQEFPFNRDLARILVAVEDSNDNIPYFTSTVYDAVAYESSPFGT
SVLQVTALDKDNGINGQLTYTIEAGNTGSVFGIDAATGLIFIARALDLTSVGFYTLTVRV
SDSGFPPLMATASVRISLMLSDYSSPKFSQKEYQAEIMENSTTGTHVATVTALSRSALFY
DISRGNDDLCFYINHHTGVINTRKLLDFEQTPSYFLVVHALSMTRMEASTTVTVQVGDVN
DNSPVFQQLRYVGTISEAAPVNSVVLGDDGNPLVIQATDMDRNHNALLVFHILDETARMF
FSIDSGTGSIRTIASLDYEIFSEFFFQVYVRDSGQPPRSADSPADVFIKVININDSPPKL
SQDTYETVLLLPTYAGVEVLQVEASDPDMTSDFTLKSVTPQLVYSLVESNVENFSVDRFS
GTVTVANPNLNKDRYQFTVKVWDGRFTSMASVTVLVRKAIDSGLLYTSPEYFASIPENIS
NVTVVTVVSTIGHRLNEPLRYTLLNAGERFVIRPTCGVVLTTGVPFDRELADSYELVVEV
SREDEILRVARVTVQVQVEDVNDNAPEFVNLPYYAAVQVDAEPESAIFKVSAVDRDTGVN
GEVSYSLKQQHRNFQMNPVTGELTLKKAFESDLSNAEYKLVLVATDGGFPPLSREVELPV
TVVNKAMPVFDKPFYGVTVREDVAVSTSILGINASSPEGQIVIFTIIDGDPSFQFDIGFD
TGTISVIYPLDYETTQYYRLTVKATDTQTGAKSEVDVDVVVLDVNDNAPLFQNTSYSSVL
PENVMIGTTVLKVFAQDQDSEKNAIVSYQILSDIYNSTDYFHIDSSSGLIFMARRLDYEL
VQRHNFIVRATDSGDPTLSSDVSVTVTVTDTNDNPPNFSQTLYEAFVSELAPRDHFVTCV
QASDADICDAQRLRYSIVSGNERMTFLMEPDTGVLRLSNKRRQGMKLSYQLNVSVSDGVF
TNTAQVIVQVLGANLYSPVFSQRFYLAEVQENAPPGSKVIQVRATDEDSGLFGQITYSFV
NDLGKTKFAVDAAGIISTLEKLDRENPLYKDMVLTVMALDGGGRASFCSVRVILADENDN
PPRFRAVEYRMSIKANVAKGSLVTQIQASDPDAGSNGRITYSLYSEARLSLVDVLEVEPD
SGWMMTKSNVDHLQGTVLSFFVKATDSGSPAKHSLVSAFIHVVPPDAFVPSFSQPQYSFT
IPEDTVVGTALGSVYMGPGQTGFFTAVVGEMVDSNQGGTFLVDRESGLIRLSKPLDYEEV
SIFRFKVAVTTRRDLIEAVTTVDLEVKILDVNDNNPLFETNTYVATVMEGMPIGTRVVQV
RALDPDWGANGQVCYREAASSDGPITSSSVFAIDSKTGWITTVSEMDHEACSSYSFEVVA
SDLGELRSLSSTTVVTIAVSDCNDNPPRFERELYRGAVKESDSLGEVVAVLKTSDRDGTD
QNRLVSFYISGGNPRGVFGLAPVQGEWKVYVSGLLDREQQDWYLLNITASDGLYVAHTAV
EVTVMDANDNRPICNQAVYSASFPEDIPVNKGILTVAATDADSGSSAEIQYSLFGIGVED
FYMDANTGELRTATIMDRETTPSYKLIAQATDGGGLFCRSDISLKVLDVNDNAPTFSSPH
YLASVYENAAPKALLTRLQASDPDEGLNRTLVYTLDSIDELFSIDPVSGMVVLEKSLDRE
SQDSYRLRVQATDQAGQRGALSTQVNLTILVLDVNDNAPVFQRRDYGVTVPEDVAVGTEV
LRVLATSVDIGLNAEISYRIRSGNELGKFNIDTNLGSIFVADDLDFEVCKDYYLTIEAWD
GGNPPLSSATVVTIDLMDVNDNAPTFSQDIYNVLVSEDASVGQMVTRVSAEDLDSQGNGR
ITYSILKGDRNNHFWIDPVTGILKVNKRLDRELVSRYSLSVQAFDSGSPAMSSTVTLNID
ISDINDNSPVFTPPNSTAIIQLNQAAGSTLLKLSVSDKDSPKNGPPFDFRIVSGNEENFF
SLDQAGTLKSNRVFDPEAPREFTLEIQVSDSGKPRLAASSWVFLRVIGNSQYKPLVSPLE
IFIVMATDTFPGGPIGRIYATDRDPNDVLSFTQKLQSKSMFKINRQDGTVVAVPGLEPGR
YQINATVSDGRFAVIADVSVQVEQVTDVLLRSALTLRFSSLSPEDLLGRYLRQIKLILRG
LAGWKWSPGQQDPLHIISLKPVSGTSGVDLLLAMERPETAGSGRIGGFYSQQELTVKLEE
AAQRGLIRGVLAGAVAVGSTCSGELECGDSLVCEQKLVMEEGSPLTYSTERVSLVSLAFG
TTEACTCPGGACPTPVELCEGQSCPADMQCVRSGPTAPSVCQCLPERLDQCADQTSLSFS
GNSYIKYRVSDGGQNGEMKLSLRIRTLQRRGVIMYTRVNPCTMLKIEGGRLWFQLDCDNT
LGIMGISDRPINDGLWHAVALELTSNYTLLSLDDSYVERRRAARAPVRLWPLAPDSSFFF
GAQVRPPSVQGGTRSQPKAQGGFQGCLGSLMLNGNELPLQNKRSRYAEIAGLSDVKLGCV
LYPDPCVSQPCLNGAMCSSLPSGGFACSCSAGFTGARCEVELTSCMPDPCQNGGDCKPVG
SAFLCSCPQGLTGLIVYLVPESLCGGGTNVLRHLDGWLCKMVFFYQHKLCDQDVNECEHS
ECGNGGECVNTFGSFFCNCSQGSEGPFCRNQTPDPGDDTQIGPGEIIGIGVLAFVFILLL
ILVMVFRKKIKFRKDPDPGLSSHAAMDVSAVSSETAYMLHKTSAGADSGGPPQVMVRPTT
HAPLPGGVSSLGIRSRDDDNPTSSEGSQISVPYLQLSSFLSDVSSIRGAASRRGIAVCSV
APNPPSGSAYRSQHSLLHKVSWEGEESSRIARVCVCKKTSCRNASSVYFRADSTSEEHSI
HSYTSESFDDNG
Download sequence
Identical sequences H3CX61
99883.ENSTNIP00000012846 ENSTNIP00000012846 ENSTNIP00000012846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]