SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012955 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012955
Domain Number 1 Region: 485-700
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-101
Family Thrombospondin C-terminal domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 358-483
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.4e-34
Family TSP type-3 repeat 0.00000432
Further Details:      
 
Domain Number 3 Region: 284-360
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000012
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 4 Region: 2-40
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0000000000144
Family Assembly domain of cartilage oligomeric matrix protein 0.00061
Further Details:      
 
Domain Number 5 Region: 220-301
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000549
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 6 Region: 79-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 132-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012955
Domain Number - Region: 49-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000791
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 188-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00194
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012955   Gene: ENSTNIG00000010059   Transcript: ENSTNIT00000013147
Sequence length 717
Comment pep:novel chromosome:TETRAODON8:1:19250619:19254149:-1 gene:ENSTNIG00000010059 transcript:ENSTNIT00000013147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IISQIKLTNIALAEIKELLKQQIKEITFLKNTVMECEACGMGGMQPRPSCVPNPCHPGAE
CRVTPEGVECGPCPDGMEGNGTHCTDVDECTVKPCHMGVRCINTSPGFRCGSCPAGYSGP
QVQGLGLAYAAANKQVCEDIDECKNNGGGCVENSVCMNTPGSFRCGPCKTGYVGDQRHGC
NRERPSQPLPPQGECIVDRDGAIECRCGVGWAGNGYLCGSDIDIDEFPDEKLNCPERNCE
KDNCLSVPNSGQEDADGDGIGDACDDDADGDGIPNMQDNCVLVPNVDQRNMDEDDFGDAC
DNCRAVKNDDQKDTDVDQFGDECDEDIDGDGILNHLDNCKRVPNVDQKDRDGDLVGDACD
SCPYVPNPDQTDADNDLIGDPCDTNKDSDGDGHQDSRDNCPAVINSSQLDTDKDGKGDEC
DEDDDDDGIPDLLPPGPDNCRLIPNPLQEDSNGDGVGNVCDKDFDNDTIVDTVDVCPENA
EVTLTDFREYQTVVLDPEGDVQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFSGVDFEG
TFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQVEQDYWQASPFRAVAQPGIQLKAVKSIT
GPGENLRNALWHTGDTSDQVKLLWKDARNIGWKDKTSYRWFLQHRPADGYIRVRFFEGPR
VVVDTGVIIDATMRGGRLGVFCFSQENIIWANLRYRCNDTLPEDFDTYRAQQVQLVV
Download sequence
Identical sequences H3CXH0
ENSTNIP00000012955 ENSTNIP00000012955 99883.ENSTNIP00000012955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]