SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013061 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013061
Domain Number 1 Region: 245-465
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-54
Family Reprolysin-like 0.00048
Further Details:      
 
Domain Number 2 Region: 556-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000968
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 890-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000112
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 836-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 5 Region: 1013-1065
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 960-1013
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013061   Gene: ENSTNIG00000010163   Transcript: ENSTNIT00000013253
Sequence length 1116
Comment pep:novel chromosome:TETRAODON8:1:19912383:19929537:1 gene:ENSTNIG00000010163 transcript:ENSTNIT00000013253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLWRTGLVCTVVAIVFATEVAGGRRDEFVHSQAAFLSGLGQYDIAIPVRVGPHGETLA
AEKPQHHQRRRRSAEDRLPDSVRTSLFYQLSTSRNNFLLNLTLQGGLLSRQFRVEYWKRG
RLAWTHPYSPHCHYVGHLNDQPHSSKVALSNCNGLQGVIVAGGEEYLIEPLVSPDNQTGA
EKGERAEGRPHVVYKRSSLRHQYKGQSCGVIDEKPMKSASWWQRTLKRLPITSGRGQWPL
KRSVSRERYVETLVVADKMMVGYHGRRDIEQYILAVMNIVAKLFQDSSLGNAVNIVVTRL
ILLMEDQPTLEINHHAGKSLDSFCKWQKTIQHRSSYANAIPDNGIAHHDTAVLITRYDIC
IQKNKPCETLGGLAPVGGMCEPERSCSINEDIGLGTAFTIAHELGHTFGMNHDGMGNACG
PLSQETAKLMADHITMKTNPFIWSACSRDYITSFLDSGMGSCLNNVPPKQEFVYPTTAPG
QVYDADEQCRFQYGVRSRQCKYAEVCSELWCMSKSNRCITSSIPAAEGTICQTNTIEKGW
CYKRMCVAYGTRPEGVDGGWGLWSAWGECSRTCGGGVSSSIRHCDSPRPTIGGKYCLGER
KRFRSCNIDECPAGSRDFREIQCSDFDGVPFRGKFYTWKPYRGVGGVKPCSLNCLAEGYN
FYTERAPAVVDGTPCRDDSVDVCVNGECKHVGCDRVLGSDVREDRCRMCGGDGSGCVSVE
GLFNHSLPEGGYEEVVRIPKGSVFIHIQELNISLNYLVLKSKGDQFFINGNLSIDTPRRF
NVAGTTFYYRRPPDGPETLEALGPTNMSLIIMVLVREENPGVHYRFNPPLNRDPLAGFAW
HFTSWSRCSALCAGGVQTQQVVCMKHSDRTVAHNHFCDKKSRPKEKRRPCNTEPCSPSWW
TGEWSECSRSCNGGLRTRQVLCKRRLSVTEEKVLDDSACSPLRPALTEPCNNRSCPPEWL
ALDWSECTPSCGPGYRHRVVLCKSGESGDTLPESKCPKHSRPTSRVRCNLKRCPPPQWVT
GPWGECSAKCGLGQEMRAVQCLTHTGQLSNECLEHQRPASMQQCKSKCDLSLSVNADNSE
ECKDVNTVAYCPLVLRFKFCSRPYFRQMCCKTCQGH
Download sequence
Identical sequences H3CXS6
99883.ENSTNIP00000013061 ENSTNIP00000013061 ENSTNIP00000013061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]