SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013143 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013143
Domain Number 1 Region: 199-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.08e-49
Family Reprolysin-like 0.00022
Further Details:      
 
Domain Number 2 Region: 414-490
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.75e-19
Family Blood coagulation inhibitor (disintegrin) 0.00057
Further Details:      
 
Domain Number 3 Region: 640-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000471
Family EGF-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013143   Gene: ENSTNIG00000010242   Transcript: ENSTNIT00000013335
Sequence length 736
Comment pep:novel chromosome:TETRAODON8:2:3464318:3476016:1 gene:ENSTNIG00000010242 transcript:ENSTNIT00000013335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGDGRALVQPKRLLQQMHGREELPHSRLDTRLQHQAPGPQNIHLAQSSFLVEAFGTSFIL
DLELNHNLLSTEYVERYYDEDGRLSQDTGGEHCYYHGRLRGVPRSWAALSTCHGLQGMFS
DGNFSYGIEPIDSDCPPSPSQEKNQHVVYRVPDVDLSPPDCPGVICVLCEGDMGARPERM
DFCCLLQVRRGQHTVQTETKYIELMVVNDHELFVQRRRSTTQTKNFAKSVVNMADAIYKE
QLNTRIVLVAMETWSSENKISVGDDALLTLRDFMKYRKESIKERCDAVHLFSGRTFMSSR
SEAAYIGGICSLTRGGGINEFGSVGPMAITLCQSLGQNLGMLRSKERASAGDCRCPDPWL
GCIMEDTSYHLPRKFSRCSVDEYLRFLQQGGGSCLFNKPSKLLDAPECGNGYVELGEECD
CGLVTECDRSGAICCKKCTLTHNAMCSNGLCCRDCKYELRGVTCREAANECDIPETCTGD
SSQCPHNVHKLDGYTCDAGQGRCFDGRCKTRDGQCMALWGYTSADRFCYEKLNSEGTEKG
NCGPDPSGQGWVQCTKQDVLCGLLLCMNLTARPSFGQLQGKLTSLTIQHQNRYMDCRGGH
AVLDDGLDLGYVEDGTPCGPNMMCLERRCIPVTTFNLSTCPGSSHSRICSHHGTCSNEMK
CICDPDYTGKDCSVFDPIPIPTPSEGPEKYRGSPSGTNIIIGSVAGAILLAAIVLGGTGW
GFKNIRRGRYDPACQS
Download sequence
Identical sequences H3CY08
ENSTNIP00000013143 ENSTNIP00000013143 99883.ENSTNIP00000013143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]