SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013300 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013300
Domain Number 1 Region: 163-276
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-39
Family Link domain 0.0016
Further Details:      
 
Domain Number 2 Region: 277-359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-24
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 55-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000444
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013300   Gene: ENSTNIG00000010393   Transcript: ENSTNIT00000013492
Sequence length 362
Comment pep:novel chromosome:TETRAODON8:13:12938489:12940436:1 gene:ENSTNIG00000010393 transcript:ENSTNIT00000013492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIAMFALLRPLLAICCCLQLPADASSRHFLYQNINTGNGHGEISFHGIRLLVESSQPSVS
ATRGSSITLPCHFHYEPETVEPRRTRVKWSLLPANAPAEASAETEVMVAIGNRQRSSGRF
RGRVRLRRSAPGDLSLVIDGLQVSDAGRYRCEVIDGLEDESVTVELKLRGVVFPYHSRKG
RYRLSFFGARQACEDQDAGLATPEQLQAAWQDGLDWCNAGWLADGSVRYPITEPRAGCGG
SAPGLRTYGEPHRLLAHFDAFCFSASIKGRVFFLKHPAKLNFSEAVRACASQQSQVAKVG
QVYAAWKLQGLDRCDAGWLADGSVRYPVATPRANCGPPQPGVRSFGFPPKSLKFGVYCSE
TS
Download sequence
Identical sequences H3CYG5
ENSTNIP00000013300 ENSTNIP00000013300 99883.ENSTNIP00000013300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]