SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013336 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000013336
Domain Number - Region: 149-239
Classification Level Classification E-value
Superfamily TIMP-like 0.0131
Family Tissue inhibitor of metalloproteinases, TIMP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013336   Gene: ENSTNIG00000010429   Transcript: ENSTNIT00000013529
Sequence length 267
Comment pep:novel chromosome:TETRAODON8:3:11187295:11191459:-1 gene:ENSTNIG00000010429 transcript:ENSTNIT00000013529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQYSSDQCSWKGSGLMHEGHARDVEQVYLRCSQGSLEWLYPTGAIIVNLRPNTISSAAA
RLSVCIKPSADSRGTNIYLDRNGKLRLLMREEDQARGKVQCFGIQEGALFVEAVPHTDIS
RRTTAFQYELLSNRPGPDARSLGAPCQPCSDAEILLAVCTSDIVARGSITKVEQKEEHSS
ISVLLSHLYRQKTQIFTGGAARARRWTGSIKMPPQCRVRSGEGEFLFTGTVRFGEAWMGC
APRYKDFLRLYQEAQLQGTNPCQVDAD
Download sequence
Identical sequences H3CYK1
ENSTNIP00000013336 ENSTNIP00000013336 99883.ENSTNIP00000013336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]