SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013343 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013343
Domain Number 1 Region: 272-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-60
Family SPRY domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000135
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013343   Gene: ENSTNIG00000010436   Transcript: ENSTNIT00000013536
Sequence length 460
Comment pep:novel chromosome:TETRAODON8:3:11248603:11250317:1 gene:ENSTNIG00000010436 transcript:ENSTNIT00000013536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTISLLDEKHFLCSLCRDIFTNPATIPCGHSFCLSCLCRYWTRHQSKYCPNCKRVFPD
KVDLCVNHILADVSTKYRTTRPQKPADEEPVHHCISLLSWWRRRLKMSLSQNVDIEQMIQ
ERLQKIERLKHSLELQKNSYLKEVRESQKVFSALVNAMEKSHKAVVSAIEKRQKEEETRM
KTLLEELKDEVQELRKVAAEPGSAVLVPIDQSEDTEEVVENTAPTLCISEMKDWSKVALE
TDPCVGVTRRALSDIWEKIKVEVNRLTKSAELKRLEKYTVDVNLSAKTAHPILCVSDDQK
QVRHTDKLREVPDNPKRFDRVANVLAKESFSCGRCYWEVEVEEKVEWNLGVVRQSINRKG
KFTVCPANGYWTLGLKTGGQYIANTSPATPLALEPRPKKVAIFLDYTEGRVSFYSAESGV
HIYTFTDTFTDRLVPFFSPGRLHAGKNAAPLVISSSFCSI
Download sequence
Identical sequences H3CYK8
ENSTNIP00000013343 99883.ENSTNIP00000013343 ENSTNIP00000013343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]