SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013347 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013347
Domain Number 1 Region: 271-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-40
Family SPRY domain 0.00025
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-19
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 70-128
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.09e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013347   Gene: ENSTNIG00000010440   Transcript: ENSTNIT00000013540
Sequence length 428
Comment pep:novel chromosome:TETRAODON8:3:11307275:11309119:-1 gene:ENSTNIG00000010440 transcript:ENSTNIT00000013540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLTCPICCEIFADPVLLQCSHSFCRSCLKRCWDTGLRECPVCRKKVSKFGASSNLALKNV
CEAVLQVKKEKLNCDLHGERLKLFCVNDKEPICVVCQTSRLHKTHDCLPIEEAIEERKNE
LSTYLKNMHDELETVERNHASCLDMFKFIKDQALQTQRLIKDQFEQLHKVLDQEESRRLA
AVKKEEEMRIAKIKDKIKDLSAEVQTLRETILAIQHQLKEDNILLLKVCIMKNHKKTKTK
HILNYYLQKKFERYSKRYRIWEKLLDDIDYNPVTLDPNTAHPCLVLSDQLTSLHYKKENR
CCPDNPERFHMSAEVVGMTALGSGSHQWVVETGSNQDWLLGVVSVSVSRKAEVSARPENG
YFALCFRDGEFMAMTSPPTPVDIKNNPKQIKLHLDFNKGTLSFFHPEEEKLIFQFRHTFV
EAVLPYFY
Download sequence
Identical sequences H3CYL2
99883.ENSTNIP00000013347 ENSTNIP00000013347 ENSTNIP00000013347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]