SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013425 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013425
Domain Number 1 Region: 275-324
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013425   Gene: ENSTNIG00000010515   Transcript: ENSTNIT00000013619
Sequence length 332
Comment pep:novel chromosome:TETRAODON8:1:973160:978322:1 gene:ENSTNIG00000010515 transcript:ENSTNIT00000013619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSAHLTCGWLLQLFLVFLKLRVAPAGPVRPLNGSECTARGPASYLLVFTGHWSPQAFP
KQYPLFRPPAQWSKLMAVSHNPHFRLWAEGVPATKGVQDFAELGVTVELMKAAKEARKKR
SVGAMYRTAGIPNGIGHSSTELLMQPQNSLLSLVVKVIPSPDWFVGVDSVNLCQGDQWKE
ELTFDLQPFDAGTDSGFTFSSPNFPTSPVEKVTKITSQLPNHPANSFYYPRLKELPPIAS
IRVTRQSRSPGRQAPMSNHILPNVISQRISETPLDCEVSPWSSWGLCLGPCSRGGVRHRT
RYILLRPANAGTPCPELEEQAECVPHSCMKRQ
Download sequence
Identical sequences H3CYU0
ENSTNIP00000013425 99883.ENSTNIP00000013425 ENSTNIP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]