SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013467 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013467
Domain Number 1 Region: 280-567
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-45
Family Kelch motif 0.005
Further Details:      
 
Domain Number 2 Region: 706-850
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-24
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 3 Region: 48-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-23
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 985-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013467
Domain Number - Region: 903-937
Classification Level Classification E-value
Superfamily Plexin repeat 0.00167
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number - Region: 16-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family Integrin beta EGF-like domains 0.085
Further Details:      
 
Domain Number - Region: 164-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 624-651
Classification Level Classification E-value
Superfamily Plexin repeat 0.0392
Family Plexin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013467   Gene: ENSTNIG00000010555   Transcript: ENSTNIT00000013661
Sequence length 1352
Comment pep:novel chromosome:TETRAODON8:10:12478875:12521960:-1 gene:ENSTNIG00000010555 transcript:ENSTNIT00000013661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAALLLAVAGLLSEAKDCDKPCLNGQCSAATGSCVCSPGWVGDQCQHCGGRFRLTGPSGS
LTDGPGNYKYKTKCTWLIEGQPNSILRLRFNHFATECSWDHLYVYDGDSIYAPLLAAFSG
LIIPERYGNETVPEVVSQSGYALLHFFSDAAYNLTGFNISYRLNMCPNNCSGRGECVLGN
SSASVSCQCQANWKGPACDVPYCLDDCGFPERGRCQDKTCLCQSGWQAGPDCSVSVPANS
SFWTREEYAEAGLARASHKAVVDQGIMWVIGGYVFNASDYPHGQSVSTLRFNLSSRSWLT
LGPSATVAPRYGHSLALHEGKIYMYGGKIDSTGNVSSQLWVFHIQNQTWVLLSPQVAQEQ
YAVVGHSAHIVPPVQKDSSATMLVLFGHCPVYGYVNQVQEYDIAKNTWTVQNTFGALIQG
GYGHSSVFDPGTRAVYIHGGYKAFSANKYGLAGDLYKYDVDKRKWTILRDSGFFRYLHTA
VIVSGSMLVFGGNTHNDTSMSHGAKCFSSDFLAYNLACDQWSALPRPDLYHDINRFGHSA
VLSDNVMYVFGGFNSLLLSDVLAYSSPSCTAFSSQAACAQAWPGILCLWNSSLEACLPWE
SSGPAADQRQPSALCSTRSYADNERCDQYTDCYSCTANTNGCQWCSGQCVSLGSNCTAAA
GAVVEYELCPKDNPSFVCSKKTSCKSCAVDQNCQWEPRNQECISLPENVCGDSWHLVGNS
CLKFITANDSYDNAKLACRSHNAVLASLTTQKKVDFVLKELQTVSRMYKTAVTPWVGLRK
INVSYWCWEDMSPFTNTSLQWLPGEPSDAGFCGYLAEPASSSLKAQSCINPVNGSLCERP
ANHSAKPCRTPCATRSTCNECTSSSSECMWCSNMKQCVTPTPTCLLPFGQCMEWYTMASC
PPENCSGYRTCGQCLDQPGCGWCTEPSNMGKGQCMEGSYRGPFQSSVPAPSSSPGQPTVP
PPALNASMCPSEASFNWSFIHCPACQCNGHSKCVNESVCERCDNLTSGRHCESCISGFYG
DPTNGGSCQPCKCNGHASMCNPNNGKCFCTTKGIKGDRCQLCEVENRYQGNPLKGTCYSA
LAASSLPVCVIKADDSAVFTALTHISSSCQPNRDLDMFINASKNFNLNVTWATSFTAGTQ
TGEEIPIISRSNIREFKDSFSNENFDFRNSPNITFFVYVSNFTWPIKIQIAFSQHSNFMD
LVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFATINVAVETE
EEPPDLIGGNVKAVPKPIALEPCFGNKAAVLSIFVRLPRGAGGIPPPGQSAGLAVASALV
DVSQQMCVGYKEKSGGLRSRKHQPAVQPSTCI
Download sequence
Identical sequences H3CYY2
ENSTNIP00000013467 99883.ENSTNIP00000013467 ENSTNIP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]