SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013733 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013733
Domain Number 1 Region: 425-477,519-634,674-742
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000565
Family Chondroitinase B 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013733
Domain Number - Region: 787-967
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0392
Family Pectate lyase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013733   Gene: ENSTNIG00000010807   Transcript: ENSTNIT00000013927
Sequence length 1389
Comment pep:novel chromosome:TETRAODON8:12:902660:929090:1 gene:ENSTNIG00000010807 transcript:ENSTNIT00000013927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPTSDGPSHFPVFVAPQHANHPRPPGYVPGRVAPVRLPPPAKAPPPPPVKPHGPPPVHR
ATFSLSEESRGKERARSLRQRRKTYICVGASTAAFFVTLILILSLRSGDVFDENCPDHNP
SLSSWNPGHQPQKAVVIRRGQLFKLETSTTLLSLTIQSGGQVVFADSPDGSKNITLRTHH
ILIEDGAALHIGAPKCRYRSYATIALMGRSDSTAVLEIPGLGRKFIGVMAGGTLELHGAE
RVSWTLLTRSVASGLSTGRYAFQRNFSRGINLRVIDQDTAAVLSCERFDTHDSRNDSQNL
TRLLLSLPHGRIVALAVGDSAVKSLLDETKKAIAEKLGSSFVYDLKYRQAWALVSEVGGG
NASCSEDVREHENHDTGGRAVASRNFTTVDGVGFSVTAYSEWKNGFPISGFQVDAVDQVV
LNLQDQVHETWKPGDQIVIASTDYSMHQAEEFTLLPCPQCTSRQVRIQGKPQYHHVGEIV
DGIDMRAEVALLSRNILIYGEMESSCYGKMCQFYSHDTFGGHVKIFRNFSSVHLSHVELK
NMGQQSENSRYPVHFHMCGDVDQRGGYWEPTYVDGLSIHHSFSRCLTIHATNGLLVKNTL
GYDTLGHCFFLEDGIEQRNTFFHNLGLLTRPGTLLPTDRNETLCTSIRDKVYKGYTPSPS
TECKFVISKTIIKSSNNNLISNAAAGSQDAGIWFVFHSSSTGESHGLVPETKAELTPLGI
FYNNRAHSNFKAGLFIDKGVKNTNASIADPREYLCLDNSARFRPHQDANSSLPRVAAVID
TLISFKNNDLGAWIRGGDIIIQNSGFADNGVGLSFASARRSSFLLFFSASVTVKHYIFIK
FYRKPMETNKYWGLGGVDEKNRTLPRNRTFPIRGFQIYDGPVQLTQSTFRGFMPRLERYT
SAVGFNLKNTWQLTPRNNLSHLSFQSTVGLRAFFGRPGQWFEENDLDGDKTSIFHDVDGT
VTGYRDTYVGRADNYLIQHPDCINMASWNGVICSGRYSQVYIQTQGAPNRILYINRNEYP
SSPLILRGINSQGAPSQQYQPVLMMAKSYTLHWNGPAPKEVVLSLINFDKDDWVLVGLCY
PPDGTLQIMADINDRQSNTFDDITDYGPVSSLAELEKKPVERKYFFDEDVGLLWLYLRAR
HDRDGHSYCSVKGCERVKVLSTTSSKQICNCMAKAYPKYSKVPSAAVPMPAPNTQPCKGC
GAKQLVFSSEPWTSHLQTQVKSLCHKEQQRGENSSFINVNGATTHFSHSGYFVVSVDACS
GKITQKKPFARMDAGMEQYLKTGIPEQRSVVLMATRGRPEGLVNFASHLVSLGFTKAADL
SSKDCLAVWGFRGVSPSPPWVSLQTGQGDEVLGLLERYLPMSLETYGCAPPAAQSRKDLE
LLKKATAPD
Download sequence
Identical sequences H3CZP7
ENSTNIP00000013733 ENSTNIP00000013733 99883.ENSTNIP00000013733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]