SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013784 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013784
Domain Number 1 Region: 36-292
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-73
Family Ras GEF 0.0000756
Further Details:      
 
Domain Number 2 Region: 457-575
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000269
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013784   Gene: ENSTNIG00000010855   Transcript: ENSTNIT00000013979
Sequence length 583
Comment pep:novel chromosome:TETRAODON8:1:12667968:12698563:-1 gene:ENSTNIG00000010855 transcript:ENSTNIT00000013979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPNGQSSATTTAATVSEKSSSSESLSEKGSSDLKKSFDAVVFDVLKVTPEQYAGQITL
MDVRVFKAIQPEELSSCGWNKKEKHSSSPNVVAFTRRFNQTSFWVVREILHSQTLKIRAE
VLSLYIRTAKKLCDMNNLHAVMAVISALQSAPIFRLSKTWALLSRKDKSSFDRLAFLISK
EDNYKRLRDFISTQSMVSCIPYLGMYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII
SDLQRSCTYDVPVLPHVQKYLNSVRYIEELQKFVEDDNYKLSQKIEPGTSTPRANASKED
LAGQEASASPLCGRKCTISSEVPATPPSPRNLLPYGHRKCHSLGYNFIHKMNTVEFKSAT
FPNAGSRHLLDDSVMESHSPSRCQAESSTLSSGISLGSSDGSEISEEVSWPAFESLLLSS
PLSQLERKIRANDREHNLSFNSAESEELAVHLYPGAVTVQGVLKRKTVLKEGKKPTVAAW
TKYWVALCGDQLYYYPAKSLKASERIAWFKSTSTKSVSVVGLMAMMADDPEHPDVFLLTD
SERGNTYKYQAGNRMNALLWFKHLSAACQSNRQQVPANLMSFE
Download sequence
Identical sequences H3CZU8
ENSTNIP00000013784 ENSTNIP00000013784 99883.ENSTNIP00000013784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]