SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013812 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013812
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000015
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013812   Gene: ENSTNIG00000010882   Transcript: ENSTNIT00000014007
Sequence length 84
Comment pep:novel chromosome:TETRAODON8:Un_random:2398868:2399119:1 gene:ENSTNIG00000010882 transcript:ENSTNIT00000014007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECSICYTTYDNVFKTPKELDCTHTFCLECLSRLMALSPADQDSDHPLKHISCPLCRRTTT
LPKEGPPALTTNHEVLRKLPHHQQ
Download sequence
Identical sequences H3CZX6
99883.ENSTNIP00000013812 ENSTNIP00000013812 ENSTNIP00000013812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]