SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013815 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013815
Domain Number 1 Region: 166-216
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000568
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000762
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 3 Region: 616-679
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000222
Family SEA domain 0.0031
Further Details:      
 
Domain Number 4 Region: 370-438
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000277
Family Ovomucoid domain III-like 0.0039
Further Details:      
 
Domain Number 5 Region: 84-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000541
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 6 Region: 262-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000865
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 7 Region: 316-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013815   Gene: ENSTNIG00000010885   Transcript: ENSTNIT00000014010
Sequence length 705
Comment pep:novel chromosome:TETRAODON8:Un_random:2454605:2481519:-1 gene:ENSTNIG00000010885 transcript:ENSTNIT00000014010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EACGNCTFGAICDAQSGQCVCPSECVESNQPVCGSDGTTYNSQCELHVRACKEQMDLRVV
SQGECKTCGGIVCAWGARCIRNKCTCPQCSGKAFSAVCGSDGTTYNNECELRESSCMQKR
RIDVVKHGSCDEDADCGSGGSGSGAESCEQDRCRMFEGSWDEDAEDDRCVCDFTCQSVPN
NPVCGSDGKNYSNECELKKARCEKQEHLLIQNQGPCAGRNLAVTPPPELTAPKHCSQSVY
GCCLDNMTAALGVGLAGCPSTCQCNTYGSYKGTCDPATGQCSCKPGVGGHKCDRCEPGFW
NFRGIVTEGMSGCTPCNCDATGSVRDDCEQMSGLCSCKTGVKGMKCNVCPDGRKMGMNGC
DKGPEAPTSCEHLVCSFGGSCIEVNGQAHCECPSPDCDEKNKTKVCGSDGVTYADQCQLR
TIACRQDKDIVVQHFGQCTVLASSPSLHQKPSSSRQTDPHPTYLPPLPAQQPPPSPPPPH
STLTWWRPFHPRGSRRREPQSGPRSLSPFPPSPTTISSTPSPALVPFEESGSGEPSGDEE
TLEEEDLEDDAGSGLPSEASGADDASAEERESCDNEEFGCCPDGRTAASNPEGSNCPATM
RFNGFLHLDQVEGQEIFYTPEMEDPKSELFGETARSIENAVNDLFRKSEVRKDFMSVRVS
NLAPSNSLLAFVEAHFKPDTRYTVEDIEGALLKQMKASKDTSIAV
Download sequence
Identical sequences H3CZX9
99883.ENSTNIP00000013815 ENSTNIP00000013815 ENSTNIP00000013815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]