SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013889 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013889
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 192-238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013889   Gene: ENSTNIG00000010959   Transcript: ENSTNIT00000014084
Sequence length 345
Comment pep:novel chromosome:TETRAODON8:14:6788476:6789892:-1 gene:ENSTNIG00000010959 transcript:ENSTNIT00000014084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TISTKEEKMEKMLFLTFLSQAAAQECGKPCSCPSAPPQCPPGVSLVLDGCGCCRVCAKQM
GELCTERDVCDPHKGLYCDFGARINRRIGVCTARDGATCVFGGAVYKSGETFQSSCKYQC
TCLDGAMGCVPLCSVNVRLPSPDCPMPRRVKVPGKCCEEWECDSPNKNSFVGSALAAYRE
EETFGPDLSMMRENCLVQTTEWSACSKSCGLGISTRVTNDNRECRLEKQTRLCMVRPCES
QLEQSIRKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVCLDGRCCTPHRTTTLPME
FKCPDGQVMKKHMMFIKSCACHYNCPGENDIFESMYYKKMVGDMA
Download sequence
Identical sequences H3D053
ENSTNIP00000013889 99883.ENSTNIP00000013889 ENSTNIP00000013889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]