SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013968 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013968
Domain Number 1 Region: 649-838
Classification Level Classification E-value
Superfamily Sec7 domain 8.37e-65
Family Sec7 domain 0.00000693
Further Details:      
 
Domain Number 2 Region: 848-991
Classification Level Classification E-value
Superfamily PH domain-like 6.49e-17
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013968   Gene: ENSTNIG00000011033   Transcript: ENSTNIT00000014163
Sequence length 1199
Comment pep:novel chromosome:TETRAODON8:19:2834041:2869756:-1 gene:ENSTNIG00000011033 transcript:ENSTNIT00000014163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLDNPMKAVLYLKELTTIVQNQQSLIQTQRQRIDELERKVEDLIGENRQLREPHPAR
PAPPPAAAAAPDAPQRQSPGASPPPSPSGEQQSVRSSGPHQHQTPPAPSSHHPQQLQLVP
TSPPSPKGSKASPESAEESKRSPCCKSLVPQTPTTLCRSVGLARKADLFPFPVTSGVFSR
RPLNQTVLHQFCCPAPEAPEETSACRKLPEDVSENKREAVGELDSSLGEEGKGGEGKLQS
EVDLPPQPDQQEEEPQSESQPQSQRLHHTASPLRVQRNGAGSHSATSDYELSLDLKNKQI
EMLELKYGGHLISRRAACKIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRVQNTE
GFSAERALAEGCNLAGVPLVRSPSLPVTVGSSLTDLEDSFTEQVQSLAKSIDDALSNWSL
KTMCSLQEGGTYQFSTDSFSTAVEGGALGEPRLPQGSIDPSDLSRNASKLMMAFRDVTVQ
IDSQNIRVSSSVVESSTSVALSSCEHQEGASTATAAASSTANTTPASAPSVPSVQPPPPA
ALSEPNIDDEEDVEFPAPPPSEEDLGEEELASLTLEDNMAAAQAQQEAVSETADNSSEQM
SSSSTSTEARSTSEASSKEALQAMILSLPRYHCENPASCKSPTLSTDVMRKRLYRIGLNL
FNINPDKGLQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKPFNRDVLDCVV
DEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPDVVQQFHNPDTIFI
LAFAIILLNTDMYSPNIKPDRKMLLEDFIRNLRGVDDGADIPRDMVVGIYERIQLRELRS
NEDHVTYVSKVEQSIVGMKSVLSVPHRRLVCCSRLFEVTDVNKAQKQAAHQREVFLFNDL
IVILKLCPKKKSSAAYTFCKAMGLLGMQFHLFENEYYPHGITIVSPFGSDKKQVFNFCAQ
SAEELLKFVEDLKESIAEVSEMEQIRIEWELEKQQGTKAPSLKTNGAQLELRARQGSPAG
SLSVVISTQFESDIGRLVSIHNRLQTYQLSSTAPSPESAALPNHQGEPLLQQAPSPQHPQ
PQSASSTPAHQLHFQQQHPQPAVSMADLRPETLIQCQQIVKVIMLDSGGLGRMEAFLGHM
LSRSAVSTPVRSPDGSQGNDGHQPPLPPPPPPYNHPHQYIPPDPRLTLHRTPSGSRSMV
Download sequence
Identical sequences H3D0D2
ENSTNIP00000013968 99883.ENSTNIP00000013968 ENSTNIP00000013968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]