SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014020 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014020
Domain Number 1 Region: 306-478,509-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-20
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 2 Region: 127-228
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000814
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014020   Gene: ENSTNIG00000011085   Transcript: ENSTNIT00000014216
Sequence length 953
Comment pep:novel chromosome:TETRAODON8:15:4218121:4245590:-1 gene:ENSTNIG00000011085 transcript:ENSTNIT00000014216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWIETSYHGVITENMDTVLLDPPLVALDKDAPVPYADSVLMSLIKPGEICAFKIY
GQDVPFEAVVLNRTSGEGILRASSPVDCESQKEYTFIIQAYDCGASLSGTDWKKSHKAVV
HIQVNDVNEFSPVFREPLYKASLTEGKIYDSILQVEAWDQDCSPQYSQICNYEIVTAGTP
FAIDRNGGNIRNTERLSYEKQQSYRITVTAFDCGQKKAQEDVTVHIDVKPICKPGWQGWN
KRVDYEPGTGSRPLFPKMHLETCEGPLSGMKVLVELQTSHIGKGCDRETYSEKSLQKLCG
AASGSTDLLPAPSPSANWTASLLTDSGRDSDLIYRFDGRQAANVPDHVVPQNLTDQFTVA
TWMKHGPSRGLRAEKETILCDSDKTEMNRHHYAIYVHNCRLVFLLRRDFTQVDAFRPAEF
HWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTDDWPIHTSKIDTQLTVGACWQ
NKSVCGLKNDTLSGGTPVCCQGGEVMPPRFTQYFRGSLSGLTIRPGRIESQKVISCLQAC
KEGLDINSLESLAKDIKFHFNPAQSVLVVEGEDVDSINAAMTKVSYINSRQFPTPGLRRL
RITTSVQCFGEDSCLSIPDIKAVVMVLQPSEPRITITGTNQLVRPAGDLRAPLGVAPFKE
LHITSTVMKGDGSGGPQRPGVMETMHNLDYCDVLVIGEELNPGKESLEIRHSALLGKHLD
ATNSTSGISIYGVDSISHYEQALRQVRYRNWRPTSLSERRFRLTCSELNGRYTSNEFNME
VSVLHHSAPVDHVNHMAANPQYMRPVHHPLMIHTFNSHMSGAAPPAATVVIVVCIAALVV
IVVIGVYRIHATHQEETRDEEDEAKEPEEDWDSSALSITVNPMENLKGLQALRKVVQDEG
CTEEEEEDGEQVGGMTSAESDYSDEEAEEEDLREVKERKRKGKLEWDSSSMKY
Download sequence
Identical sequences H3D0I4
ENSTNIP00000014020 99883.ENSTNIP00000014020 ENSTNIP00000014020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]