SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014031 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014031
Domain Number 1 Region: 309-500,601-857
Classification Level Classification E-value
Superfamily Ras GEF 5.23e-109
Family Ras GEF 0.0002
Further Details:      
 
Domain Number 2 Region: 53-190
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-39
Family DEP domain 0.000000934
Further Details:      
 
Domain Number 3 Region: 509-610
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-33
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 4 Region: 183-312
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-25
Family cAMP-binding domain 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014031   Gene: ENSTNIG00000011096   Transcript: ENSTNIT00000014227
Sequence length 859
Comment pep:novel chromosome:TETRAODON8:15:4361000:4367883:1 gene:ENSTNIG00000011096 transcript:ENSTNIT00000014227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYRQSLAGLLAPPYGAMESGSNNDRLSDKDNMNCSSHPHLPFSPVLNAQIPSEKLQRAGK
VLRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWLVLQSACVLTRSHAVGMWQALLEE
RVLNHVDQDLGFQDKYLFYRFLDDEDEDTPLPSEEEKRESEEELPETILFLAQIGPDALL
RMILRKPPGQRTGDDLEIIYDELLHIKALAHLSNTVKRELASVVIFESHAKAGTVLFNQG
EEGTSWYIIQKGSVNVVIYGKGVVCTLHEGDDFGKLALVTDSPRAASIVLREDNCHFLRV
DKEDFNRILRDVEANTVRLKEHDQPVLVLEKSPRASTLGSIKYTVISGTPEKILEHFLES
MRTDIHPSEPGTKNPAVDDFVLMHCVFMPNTQLCPLLIRACTYHAASPPGSEQEKFEFAL
NCKRRALTLTLRWANTHSYLLQEEPASISFLEELYGSLSNDSRMSRALKDFLTELEKIVK
LHSEEAKVNKKKTLIRQFSNGEERLQRKQPIRNQDDILLKVYCSDHTYTTIRITVAATGR
EVINAVADKLGSTDELLLVHLSSAGEKQILKPNDVSVFSALSINGRMFACPREQLSSLTH
LPDQEGPSAGSMTTFELMSSKDLAYQMTMFDWELFSCMHEHELLYHTFGRQNFRRTTANL
DLFLHRFNQVQLWVVTEVCLCSQLSKRVQLLKKFIKIAAHCREFKNLNSFFAIIMGMSNP
AVSRLSQTWEKLPTKFKKFYAEFENMMDPSRNHRSYRLTVTKLEPPIIPFMPLLLKDMTF
THEGNKTFIDNMVNFEKMRIIANAIRQVRLCRSQPFTDPDICQPNKNQAEVRGYVRKLCV
IDNQRALTQLSYRLEPRRT
Download sequence
Identical sequences H3D0J5
99883.ENSTNIP00000014031 ENSTNIP00000014031 ENSTNIP00000014031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]