SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014109 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014109
Domain Number 1 Region: 404-483
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.49e-33
Family Cap-Gly domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 244-347
Classification Level Classification E-value
Superfamily Cap-Gly domain 0.000000000000327
Family Cap-Gly domain 0.00025
Further Details:      
 
Domain Number 3 Region: 54-201
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000017
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014109   Gene: ENSTNIG00000011174   Transcript: ENSTNIT00000014305
Sequence length 483
Comment pep:novel chromosome:TETRAODON8:Un_random:92109750:92111940:-1 gene:ENSTNIG00000011174 transcript:ENSTNIT00000014305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVIHPAAQAPVPKDYGFTFFDPNDPACLEILMDPRTTVPELFAIVRQWVPQCCSTRTTSS
ATRCLKRGCHVNDRDGADRQLLHYSCKARRPAAVGDPAAALRLSSQLISLGADVSLRSRW
TNMNLHYAAYFELIPELITAVLLKAAKTQSASTPPAGTSHYGTALHMRLRSNLCLLAHVK
CLLEHGADPSVRNDQGLVPADVVPDPMDMSLDKAEAAMVAKQSLIDAVPLSCSLPICATL
PNYLTTSPRNLMLSSLGLKLGDRVQLDEAKTGTLRFCRDHRVRQRPVGWAWKLDEPRGRR
TTAASGGVRYFICPPKLGIFAPVSKISKVVDQTPPVCSVHPQDPVWTLASRLSCRRPRRR
RRSARKVSGGGRPGQLESGRGGCSPAGIRRPGLCSLSPEEEDLELASLDPEGLNVEVGDQ
VLVAGQKHGTVRFFGKTDFAPGYWFGVELDQPTGKHDGSVFGVRYFSCLPKYGVFAPPSR
VQR
Download sequence
Identical sequences H3D0S3
ENSTNIP00000014109 99883.ENSTNIP00000014109 ENSTNIP00000014109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]