SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014125 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014125
Domain Number 1 Region: 221-280
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 2 Region: 130-184
Classification Level Classification E-value
Superfamily BPTI-like 2.84e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 
Domain Number 3 Region: 305-359
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014125   Gene: ENSTNIG00000011190   Transcript: ENSTNIT00000014321
Sequence length 441
Comment pep:novel chromosome:TETRAODON8:Un_random:92243213:92246498:1 gene:ENSTNIG00000011190 transcript:ENSTNIT00000014321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVAGASVLLLGLLLGPLPGASPARGCEWDSSEGRGLDLESFRPHLGSPTDVADAEECKA
ACCSRRGCDAALVGAPQDGALRCHLVTCWLLGSDQCRLSNASQFQVHRRRRQLLGDPREE
TQGPVLSPLARCRLPMKVGSCRAAFPRFFYDVTNQSCREFIYGGCEANANNFEAKEDCEA
TCRGVTGNTLSPGSVLPDESRSAHEKAPRMAPRLYQVMSAGDFAEQCGAEPEVGPCRAAL
PHWYFDSEAGSCKPFVYGGCRGNRNNYPSKQKCEDTCTGVTVLPASKKVGVADDLEGKGG
HERPSEHCVAKPDAGPCRAAFPAFFYDPDTNSCQPFIYGGCRGNGNRYNSREECLSRCSV
NGRVHFGRAGRRWTAGFFLFVTLAAISALLLAALIIFTLKRRAFTRQTSSISDKQELLPE
AEDQLSVDSLSLPESPKGNQA
Download sequence
Identical sequences H3D0T9
ENSTNIP00000014125 ENSTNIP00000014125 99883.ENSTNIP00000014125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]