SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014278 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014278
Domain Number 1 Region: 41-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000457
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014278
Domain Number - Region: 283-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0223
Family I set domains 0.036
Further Details:      
 
Domain Number - Region: 174-203
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0628
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014278   Gene: ENSTNIG00000011335   Transcript: ENSTNIT00000014476
Sequence length 350
Comment pep:novel chromosome:TETRAODON8:Un_random:13117996:13119940:1 gene:ENSTNIG00000011335 transcript:ENSTNIT00000014476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPFFLLLLLLRCPDVQSYEAPADKQDVFAKTACPAFLTFRNVAFLSGVTVELSCHCKPE
MVTSVMWFYRKHRHGSKETRVLNDHHGNKLVDPSNILHSRSLQSRFSIRLFSLLIFRAGR
EDSGVYICGSSQRDYFYGYDLDIQEAQKIVFIQSAETETTDGHSPAQSWYQLFTTFRPWS
VCDRCGISGEQIRIGLCYIHSHTLHVRYRGAQQTIVSCGSGGVPKAIRRMKKSRAGAKME
VRSCQVICPSPPVPSSRIGSLLSFIGLKGRPWDLPVYYLNHPAEHILTLGCPGAQANMAV
AWDFGSKPIYRSEYLAGRGVTSPRLYLDAGHHLVFDPAEVRDSGKNCCKL
Download sequence
Identical sequences H3D192
99883.ENSTNIP00000014278 ENSTNIP00000014278 ENSTNIP00000014278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]