SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014490 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014490
Domain Number 1 Region: 137-385
Classification Level Classification E-value
Superfamily vWA-like 1.85e-78
Family Integrin A (or I) domain 0.0000000303
Further Details:      
 
Domain Number 2 Region: 381-471
Classification Level Classification E-value
Superfamily Integrin domains 4.18e-30
Family Integrin domains 0.0000639
Further Details:      
 
Domain Number 3 Region: 637-720
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.11e-22
Family Integrin beta tail domain 0.00015
Further Details:      
 
Domain Number 4 Region: 31-88
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000023
Family Plexin repeat 0.00073
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Integrin beta EGF-like domains 0.0014
Further Details:      
 
Domain Number 6 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014490
Domain Number - Region: 94-160
Classification Level Classification E-value
Superfamily Integrin domains 0.00068
Family Integrin domains 0.0021
Further Details:      
 
Domain Number - Region: 522-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 477-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family Integrin beta EGF-like domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014490   Gene: ENSTNIG00000011540   Transcript: ENSTNIT00000014689
Sequence length 800
Comment pep:novel chromosome:TETRAODON8:2:9111345:9133294:1 gene:ENSTNIG00000011540 transcript:ENSTNIT00000014689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAMRSPATWTWRAALTCALLQAVVHGVRGLNICTGGSATSCQECLLIHPSCAWCAQDDFG
QRKTLTSRCDFEQNLVKRGCDQRFVESPSSSISVLQNVPLSSKGVSQYDVVQIMPQKMAL
SLRPGGQTWFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAYEMGKLTSNFR
LGFGSFVDKNMSPFSYTAEKYRENPCNGYKPFPNCVPTFGFRHILPLTDKVDSFNVEVQK
QMVSRNRDAPEGGFDAILQAAVCKEKIGWRKEAYHLLVFATDDVPHLALDGRLGGLVEPH
DGQCHLDDGSEYSASTKMDYPSLALLGEKLAENNIFLIFAVTKQLYIIYKNFTALIPGTT
VEILDQDSKNVIQLIIAAYNNIRSKVELSVWDHPEDLSLSFTATCQDGMPLPGLKKCADL
KIGDTVSFNVSVEARSCPPRGANHSFTIKPVGFKDRLEVSVDYRCDCGCSEVAQVNSSVC
NSTGTYNCGICHCEPGYLGAHCECQESEASTIYLNACRGAEGKQVCSGRGKCSCNQCLCY
ESEFGKIYGSFCECDDFSCARHKGILCSGHGECHCGECKCHAGYVGDNCNCSTETSSCIS
DDGQMCSGRGSCVCGRCQCTEPGSFGDTCEKCPTCPDACDTKRKCIECRLFNSGGFTDNQ
TCQRLCKDEIITVETLNTDDRNAVLCLYKTDDNCVMKFTYSEHTSGQSILTALKEPECGT
GTNVLMVLLAVVGSILLVGVVLLAAWKLVITVHDLREFSRFQSARSRARYEMASNPLYKQ
SVTHDMKSDFSMYGIPYNGG
Download sequence
Identical sequences H3D1V2
99883.ENSTNIP00000014490 ENSTNIP00000014490 ENSTNIP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]