SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014516 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014516
Domain Number 1 Region: 34-151
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-39
Family Frizzled cysteine-rich domain 0.000000542
Further Details:      
 
Domain Number 2 Region: 178-289
Classification Level Classification E-value
Superfamily TIMP-like 3.45e-26
Family Netrin-like domain (NTR/C345C module) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014516   Gene: ENSTNIG00000011566   Transcript: ENSTNIT00000014715
Sequence length 301
Comment pep:novel chromosome:TETRAODON8:2:8865630:8869829:-1 gene:ENSTNIG00000011566 transcript:ENSTNIT00000014715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSLSPRQHMLSAGFSVSLLAVSCALWPPAVRAASCETVRIPLCRSMPWNMTKMPNHLHHS
TQDNAVLAIEQFEGLLGTGCSPDLLFFLCAMYAPICTIDFQHEPIKPCKAVCERAKSGCE
PVMIRYNHSWPDSLSCSELPLYERGVCISPEAIVKAEGPGFPMDMNNLHCRGPNGDRCRC
KTVKMNVRTYVKNNYNYVIRARVKEVRNRGLEPTAVVDVKEVLKSSLVNIPKETHTLYYS
SSCLCPPLAIGEEYLIMGYENEERSRLLLIDGSIAQKWKDKMTRKIKRWDQILQRRGQTS
S
Download sequence
Identical sequences H3D1X8
ENSTNIP00000014516 99883.ENSTNIP00000014516 ENSTNIP00000014516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]