SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014530 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014530
Domain Number 1 Region: 101-296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-50
Family SPRY domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014530
Domain Number - Region: 287-323
Classification Level Classification E-value
Superfamily SOCS box-like 0.0314
Family SOCS box-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014530   Gene: ENSTNIG00000011580   Transcript: ENSTNIT00000014729
Sequence length 368
Comment pep:novel chromosome:TETRAODON8:Un_random:6818619:6820413:-1 gene:ENSTNIG00000011580 transcript:ENSTNIT00000014729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSSTVEAAFAMSRRSRNSRAWRYVWGGIRRDADARALVLASEREDWSYDLVEFSDSDSE
ADFSPVVVPTVPSAVPVTGESYCGCDSQAEAGYNPRLRGFHQVKDCHCGEDDQEFDWVWD
TNSRSTATLLSCENRKVSFHSEYSCGTAAVRGSKELADGQHFWEIKMTSPVYGTDMMVGI
GTSDVNLDKYRHTFCSLLGKDTDSWGLSYTGLLHHKGDKISFSSRFGQGSIIGVHLDTWH
GTLTFFKNRKCIGVAATELRNKRFFPMACSTAAKSSMKVIRSCSAPTSLLYLCCARLRQL
APDSIDVLDQLPLPPGLRQLLHNKLGWVLSLSGGSAEETVAGPSSSESDSEGSASDPEAC
QRKRCRWM
Download sequence
Identical sequences H3D1Z2
ENSTNIP00000014530 ENSTNIP00000014530 99883.ENSTNIP00000014530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]