SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014574 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014574
Domain Number 1 Region: 169-366
Classification Level Classification E-value
Superfamily E set domains 1.31e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000962
Further Details:      
 
Domain Number 2 Region: 62-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-23
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014574   Gene: ENSTNIG00000011622   Transcript: ENSTNIT00000014773
Sequence length 398
Comment pep:novel chromosome:TETRAODON8:Un_random:7748529:7749722:1 gene:ENSTNIG00000011622 transcript:ENSTNIT00000014773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGRTHRHSFLSIEEEGLRLGTMPAVGSFGNGKIHTRRKHHSRFVSKAGQCNIHFSNMD
EKSWRYISDIFTTCVDIRWRYMFLLFSLVFVVSWLMFGLAFWVIGLLHGDMDRSRMTDGF
VPCVTQVNTFVTAFLFSVETQTTIGYGARCVTEECPAAVFMVVFQSIVGCIIDAFMIGAI
MAKMARPKKRAETLLFSHNAVIALHDGKLCFMFRVANLRKSHIVEAHVRAQLLKPRYTEE
GEYIPLDQIDMNVGYDKGTDRLFLVAPLTVVHEIDEESPLFGISKQDLESSDFEIVIILE
GLVEATAMTTQARSSYLPSEILWGHRFEPVIFEEKSQYRIDYAFFHKTFEVPSTPRCSAK
DMEERKFLTSGANSFCYENELAFISRDEEEEDVNSERD
Download sequence
Identical sequences H3D236
99883.ENSTNIP00000014574 ENSTNIP00000014574 ENSTNIP00000014574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]