SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014602 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014602
Domain Number 1 Region: 134-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000249
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 1207-1264
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 557-621
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000876
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 956-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 291-348
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000955
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 694-748
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000101
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 1090-1138
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1262-1312
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 9 Region: 826-881
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 1334-1398
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000327
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014602
Domain Number - Region: 1142-1194
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000405
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number - Region: 754-825
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000562
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number - Region: 61-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00262
Family TSP-1 type 1 repeat 0.0091
Further Details:      
 
Domain Number - Region: 1014-1073
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number - Region: 621-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00392
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number - Region: 887-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0183
Family TSP-1 type 1 repeat 0.016
Further Details:      
 
Domain Number - Region: 255-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0432
Family TSP-1 type 1 repeat 0.021
Further Details:      
 
Domain Number - Region: 355-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0497
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014602   Gene: ENSTNIG00000011651   Transcript: ENSTNIT00000014802
Sequence length 1584
Comment pep:novel chromosome:TETRAODON8:Un_random:29391455:29413189:1 gene:ENSTNIG00000011651 transcript:ENSTNIT00000014802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLFSGPWGRCMGSICGPGGSQSRVVWCAHVEGRTTLYTNCESTQRPPNTRSCFRVCDWH
RDLHEWKLGAWNECMPISARTLVSSQPAKCSGGEEGIQTREVTCVVKSDDSPAEDAICEY
FEPRPHLEQACLIPCPQDCIVSEYSPWTSCSKTCGTGLRNRIRRILVPPRFGGIACPNLT
EFRSCKPEPCNGPEGLYSLRVEPWSPCVLPNTRPTRQVKRRKAGVTDPKSRELTGTEQTR
NRLNWEESSTWDIQVGYQTRNVTCVHRNGSSVERNLCTLMDLPTTVRPCLLPKDCQVSEW
TEWSLCSKTCTDFNGSKGNRTRKRQVLQLPVGEEQDCPPLEETESCEPPRETSLPCANYT
WRTTEWSDCSTDSLLSQQDNRRSSRNVTGLCGGGLQTRDLYCVQTNAELLNYLSEFREKD
KVLWLGQTPLEKMLLNXPCPVECEVSPWGAWGPCTFENCDDQAGTKGTETGLKEIINEPT
EGPETCPHLEEAVPCEGPACYSWQLVRLDLCAPRDDKTCGPGTRVAHVKCVNISGEEVDR
TMCASSPDLGPVLCEVPCSRDCVLSDWTSWSTCSQTCSSKTMEGKQMRMRSILAYNAGEG
GAQCPNSSALQEVRNCNEHACTVYRWQAGPWGLCAENTSPSSGNTTRAQGPCLRGLQTRK
VICVRAGVGQVPPKKCSEGSRPSSARACALCRKDCIVTPFSDWTPCPVTCDAAGNVVKLK
QFRKRLIIQQPSNGGRECPKILQEQRDCELPETCPGFRWKTHKWSKCHLAPWLVRQNSSG
AQETCGAGLQTRALSCFQLNGTQADVSDCLKFTKAMPSIAQPCQLPCQDDCQLTNWSKFS
SCTVDCVGVRIRKRTLIGRSKKKDKCKNTQMYPLSETQYCPCNKYNAWPVGNWSDCILPK
RDRLDNVLGLKVPGDIKQCGQGYRYQAMACYDQDNRLVETARCNSHGYIEEACSVPCPSD
CKLSEWSNWSRCSKSCGSGVKVRSKWLREKRYNGGRPCPKLDQRNQAQLYEVVPCRGDCN
QYVWVAEPWSLWKVSHMDLKQNCGEGVQTRKVRCLLNTVDGPSEAVENYLCDPERMPLGT
RASQLPCPDNCVLGDWGPWSPCSLPCTRANNRVRSRYVLRQPTQGRKCPDLLDKEPCSLN
LNCFNYFYNITEWSTCQLSPNAMCGDGIKTRMLDCVRSDGKSVDLKHCQKLNLEASWQLN
LSCVVECPVNCQLSEWSDWSTCSQTCGLKGKMSRQRWVVQASQGDGRPCPSQMAQWKPCP
VQPCYQWKYSSWSQCQVENVVCGTGTRYRNLSCVVSDGSFHDEGSLVDDELCQSLELTVN
GFTPVRLKEACTLPCPGDCYLMEWSDWSSCAGVCVRGAALDYVSVQVRSRAVLAQEPENL
QLCPDQQWESRPCTGGKCYDYKWLRGLNSSSPAVWCQRSDGVNVTGGGCPGTSPPAGGRS
CDPPCLTPKSRCGEDGVCTCEQGFTEVFLHTGQLTQCAPTPILEIPTWEDKKGDVKTIRA
IDTPSPTSVLPGLPGRTWYLQPYGPDGKLKIWVYGVAVGAFVLFIFIVSVIYLACKQPKS
PQRQSQPSNQLKPLSLAYDGDTDM
Download sequence
Identical sequences H3D264
ENSTNIP00000014602 ENSTNIP00000014602 99883.ENSTNIP00000014602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]