SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014826 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014826
Domain Number 1 Region: 335-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-48
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 86-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000916
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014826   Gene: ENSTNIG00000011869   Transcript: ENSTNIT00000015027
Sequence length 535
Comment pep:novel chromosome:TETRAODON8:2:2178265:2183174:1 gene:ENSTNIG00000011869 transcript:ENSTNIT00000015027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTDSKAAEETKIQEDLKESEDPRKPEEEPKEEEKEEPLGPDDMVCDSCIENPRRAIKSC
LTCLVSYCEAHLRPHLENPKFQNHRLVEPLQDIERRTCESHKWPLELFCQADNSCICQDC
VEEDHRGHNVVSVVKARQQIEKELREKQTETVKEVTAAENAINKLQLNTVSIENSVTEVR
GVIESHFDELLVAVERVKREVLEILEGEEKQALKQAEGIRVHLEQRCMELKKMQAQMEKL
SKNKNDVDFLQEYSEWKKEVTDISLPGVYIGLMDCLNSFSRVIVNSTQEICSTLESSYLE
KVKETCKNDNMGIKTTVHQIVAAKQNLSVPDPVTHDDFLKYFAQLSFDPDTAHKFLRLTG
ENRRVTNTTPWQHPYPDLPERFESWRQVLAKESFYLGRHYFEVDIGGEGTHIGITYKSID
RKGSESNSCITGNNFSWCLQWNGRTFSAWHSDVETPLNVEKFTRVGVYVDYTKGFLAFYG
IEETMALIHEYKAEFLEPLYAAFWLSKKENVVALVAPEEPLQLKSPSPPMSPSSG
Download sequence
Identical sequences H3D2T8
ENSTNIP00000014826 ENSTNIP00000014826 99883.ENSTNIP00000014826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]