SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014844 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014844
Domain Number 1 Region: 172-368
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.82e-56
Family Prokaryotic proteases 0.000000727
Further Details:      
 
Domain Number 2 Region: 383-479
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family HtrA-like serine proteases 0.0016
Further Details:      
 
Domain Number 3 Region: 35-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 112-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000503
Family Ovomucoid domain III-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014844   Gene: ENSTNIG00000011886   Transcript: ENSTNIT00000015045
Sequence length 482
Comment pep:novel chromosome:TETRAODON8:2:2448378:2457444:-1 gene:ENSTNIG00000011886 transcript:ENSTNIT00000015045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLISESFHSPIMRLGLLLCALAMLVAEARIVKRLAIGCPEKCDKSQCAPIPADCLAGDAL
DRCDCCPVCASGEGEQCGGSGDRDCAEGMECLVADGVEVSATVRKRGAAGLCVCTSSEPV
CGSDGVSYRNICELKRVSNRAVKLQRPPVILIQRGACGEGQQNPDSLRYKYNFIADVVEK
IAPAVVHIELYRKTIFTKREVAVASGSGFVVSEDGLIVTNAHVVANKHRVKVELKSGATF
DAKIRDVDEKADIALIKIDAPMKLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVS
TTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSD
KIRQFLAESHDRQARGQTVQKKKYIGIRMMSLTPTLAKDLKERQSDFPDVTSGVYVIEVI
SRTPAERAGLHEKDVIISINGEPISLASDVSDAIKGGDALRMVVRRGNEDVILTVVPEEI
DP
Download sequence
Identical sequences H3D2V6
ENSTNIP00000014844 ENSTNIP00000014844 99883.ENSTNIP00000014844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]