SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014845 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014845
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.19e-54
Family Reprolysin-like 0.00032
Further Details:      
 
Domain Number 2 Region: 293-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000123
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 644-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 584-641
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014845   Gene: ENSTNIG00000011887   Transcript: ENSTNIT00000015046
Sequence length 703
Comment pep:novel chromosome:TETRAODON8:Un_random:92665580:92689765:-1 gene:ENSTNIG00000011887 transcript:ENSTNIT00000015046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETLVVADRKMLEKHGRDNVTTYVLTVMNMVSSLFKDGTIGTDINIVVVGLLLLEEDPLG
LTISHHADQSLNSFCQWQSGLLGKGGKRHDHAVLLTGLDICSWKNEPCDTLGFAPISGMC
SKYRSCTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKTEGNIMSPTLAGNNGVFFW
STCSRQYLSRFLGTNQASCLVDEPKQIGQYKYPEKLPGQLYDADTQCKWQFGSKAKLCSL
DFVKDICKSLWCHRAGHRCETKFMPAAEGTTCGPDMWCRRGQCVKFGEHGPKAVHGQWSA
WSQWSDCSRTCGGGVMYRERSCTSPRPQNNGKFCPGSSRFNQLCNTRPCPPHAVDFRAQQ
CAEHNSKPFRGWYYKWKPYTKVDDEDICKLYCIAEDFDFFFAMSSKVKDGTPCSKSEKNV
CIEGVCEAVGCDQVLGSQASLDACGICKGDNSTCKFFKGQYTLQHRANEYYTMVIIPAGA
RSVHVQEMEVSTSYLAVRSMKKKYYLTGDWTVDWPGKFHFGGTTFDYQRSFNKPESLYAA
GPTNETLVFEIKCCGYVLKDDISRMWWEKLLMEHFSAVVPQFKHWAPADWGPCSRSCGAG
QQTRLLRCLRKVTYQREEVVAHSLCPIISPAQVQPCQTQTCPPEWSTGSWSQCSKTCGRG
LRKRSVFCSSTDPGVTAVVVPDSMCRQHHKPKAHETCVLRRCP
Download sequence
Identical sequences H3D2V7
ENSTNIP00000014845 99883.ENSTNIP00000014845 ENSTNIP00000014845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]