SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014892 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014892
Domain Number 1 Region: 57-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000645
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 2 Region: 19-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000242
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014892   Gene: ENSTNIG00000011933   Transcript: ENSTNIT00000015093
Sequence length 326
Comment pep:novel chromosome:TETRAODON8:Un_random:93786044:93790508:-1 gene:ENSTNIG00000011933 transcript:ENSTNIT00000015093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRKCCDGFRFVMGQCIPESVDVCATSPCEQQCTDNFGQVVCTCFLGYRFDRERHRSHKSP
YCLDIDECDQPSSNMCDHECVNTVGSFLCRCHSGYLLAPDGHSCVPVHSLRSTGKSDTLM
SAGSCSFTCQDFMSMKSSLLQLKLKLGNMQSPNQVPGLANSSNKPVGRTGSPGPPGAPGV
PGHPGEPGRKGEPGEKGLPGPQGPRGDMGPIGPEPDLNHIRRGRRGPVGPPGAPGQDGQK
GDRGAPGPRGSPGPPGSFDFLLLMMADLRNDIIELQEKVLGGSPSISMDHPSHSSGEMEL
VEWGSGQGDAKRGQQRDEEQPGSLYR
Download sequence
Identical sequences H3D304
ENSTNIP00000014892 ENSTNIP00000014892 99883.ENSTNIP00000014892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]