SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015320 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015320
Domain Number 1 Region: 7-143
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-45
Family C-type lectin domain 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015320   Gene: ENSTNIG00000012352   Transcript: ENSTNIT00000015525
Sequence length 149
Comment pep:novel chromosome:TETRAODON8:Un_random:14796949:14798183:1 gene:ENSTNIG00000012352 transcript:ENSTNIT00000015525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAALTMSLLTDKKCPTGWKMFRSSCYYISAGKKRWKDSRDYCKTKRADLAIIKTQEEMT
FINSLFGSDKEVWIGLTDEGSEGQWKWVDGSPLTTAFWGDNQPNSYDGRNQDCVEFWHHA
TGNGDWNDEHCNVENNWMCKISPQFSPVL
Download sequence
Identical sequences H3D482
99883.ENSTNIP00000015320 ENSTNIP00000015320 ENSTNIP00000015320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]