SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015395 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015395
Domain Number 1 Region: 3426-3611
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-38
Family Laminin G-like module 0.00081
Further Details:      
 
Domain Number 2 Region: 3692-3913
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-35
Family Laminin G-like module 0.00052
Further Details:      
 
Domain Number 3 Region: 1541-1557,3200-3373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.07e-34
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 309-394
Classification Level Classification E-value
Superfamily Immunoglobulin 6.67e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 2748-2835
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 1872-1925,2261-2301
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-19
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 3103-3195
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-18
Family I set domains 0.0096
Further Details:      
 
Domain Number 8 Region: 3025-3113
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 9 Region: 2565-2662
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 10 Region: 2657-2754
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 11 Region: 1674-1757
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-16
Family I set domains 0.0000948
Further Details:      
 
Domain Number 12 Region: 2835-2922
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000104
Family I set domains 0.0099
Further Details:      
 
Domain Number 13 Region: 2379-2464
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000278
Family I set domains 0.024
Further Details:      
 
Domain Number 14 Region: 2932-3023
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000021
Family I set domains 0.023
Further Details:      
 
Domain Number 15 Region: 1784-1869
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000521
Family I set domains 0.041
Further Details:      
 
Domain Number 16 Region: 1579-1662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000959
Family I set domains 0.017
Further Details:      
 
Domain Number 17 Region: 1061-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000879
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 18 Region: 668-720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 19 Region: 227-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 20 Region: 1463-1515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000213
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 21 Region: 116-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 185-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 23 Region: 271-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 3634-3678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000489
Family EGF-type module 0.009
Further Details:      
 
Domain Number 25 Region: 3370-3411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 1522-1569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000146
Family Laminin-type module 0.062
Further Details:      
 
Domain Number 27 Region: 1119-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 28 Region: 728-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.079
Further Details:      
 
Domain Number 29 Region: 789-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.048
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015395
Domain Number - Region: 628-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000524
Family EGF-type module 0.094
Further Details:      
 
Domain Number - Region: 1427-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0015
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 1025-1063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00346
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015395   Gene: ENSTNIG00000012425   Transcript: ENSTNIT00000015600
Sequence length 3916
Comment pep:novel chromosome:TETRAODON8:9:10174327:10206451:-1 gene:ENSTNIG00000012425 transcript:ENSTNIT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYYRALVNFTDSLVYGPELEDIYSVAFNEISEAVVDTLQSEYNRIPGTQTVNVVLIKKVV
REDGVDVFVELDVGSDYNSNDEQIRSVLYNVVREGAIASYVTSVQGFQFRRLGEVSPVVR
ACMADEHRCGDGTCILMEYLCDNRPDCRDMSDEANCESRQSPPPVFTTPPTTTTPVKKPA
VLPRPAGPCRVDQATCQNGECISRDYVCDGERDCSDGSDEFRCGTPSPCEPNEFKCKNGR
CALKLWRCDGDNDCQDNSDETDCPTRGPGDRCAPEQFECLSDRTCIPASYQCDEEPDCPD
RSDEYGCTPPSVTSPPEESVQAARGSTVTFTCQAVGVPMPIITWRLNWGHIPASARISMM
SENGRGTLTIRDVKESDQGAYTCEAINAKGLVFGIPDGVLTLTSTSNPGNCPEGHFGVDG
RCISCFCAGITKSCKNTGRYRNHISLRFTDEDDFKGVNVTYPSRPGIPPLSSTQLLIDPE
MEEFQLVDLSRRFLSLDSFWTLPRQFLGNKAHSYGGSLKYKVRYTLARGSSEVVERPDVI
LVGNGRRLVYRRGSPTPARVANQKEIKFTEDNWQHSNGRSVTRQDLMMTLANLDSISIRT
VYDSHMVSAALSDVVMDTTTVEFSILGHAKNVEECRCPPGYYGLSCETCSPGFERVSGGS
YLGTCAGCNCNGHASACDPVNGHCLSCQHHTEGPRCDKCRSGYFGDPSRGRPDDCKPCPC
PYYETSRRFSNTCFLDVDNQPTCDACRLGYTGRRCEKCASGYQGNPVLPNGKCVSDQSST
CDNRGVVSSSSRPCSCKNNVAGALCDQCKAGFFHLSAANPDGCLRCFCMGVTKQCASSTW
NREQVRGAVNGQLFSLSNSGNTKTFREGISQTSSSEVVYRSFSSLPRDVYYWVLPESFRG
DKVTAYGGELQYTVRFSPSLPAQMINDQPDVVLQGNGIFLEHYSETRPAPHASQSISVTF
REAAWRRADGQACTREHLLMALADISVFMIRATYMDNMAESSRITDIRMDIAVPEAVGSQ
PALEVEQCACPQGYRGPSCQECDAGYTRASSGLYLGTCERCNCHGHASSCDPESGSCLQC
LHNTAGPRCERCQPGYYGNPVTGGAQACQPCPCPGTASSNQFSSTCYQDTDGQPTCDSCP
PGYAGRRCERCGPGYSGNPLLGQRCSQDTGDCYPCDQRGSEGCNNGGACRCKMNVEGPTC
TSCKPGNFHLSSENKDGCLSCFCMGVTQQCFSSTYYRDLVSSVFSPGNFQGFALVNQQRT
TRISTGFTVEVSTEGTQLSYSSFDYLGQEPHYWQLPGAFQGNKVGSYGGKLQYTISYVAG
PRGTVLDDGDVQIIGNDITLVARQPWRRRQQGGRATQKFQLVFREENWRRPDGMPATREH
LMMVLADLDDILIPASYSTEMRSSSISDISMEVAVPNYSGLAQALEVEQCRCPPGYQGLS
CQDCAPGYTRTGGGLYLGHCELCECNGHSDSCHPETGICSSCLHNTQGELCEQCAPGFFG
DPTVGTPEDCQPCACPHADPDNQFSPTCESLGNGGYQCTACQPGYTGQYCERCAPGYVGN
PQERVKCRPYDAAASLVVKVFPERVLTPQNSPVTLRCQVYSNPPHYFFWSREDGRSISGS
AERRRQGAELYFPNVQPTDAGVYVCTCRDQRGTNRSRAEIVVTNVQSKAIEVTVEAPKSQ
TVRVGSTVSFICTAKSKSPAYTLVWTRMGNGKLPNRAMDFNGILTIQNVQPEDAGVYVCT
GSNMLAMDEGNAVLYVPEASQTRMFYTAYEMFEGHRKPGDGAQPVASVTPPVLNVQQGQR
AEFRCTATGNPTPAIEWAGGPGSRMSPRAVIRGGVLTFAAVDAADEGEYTCKALNTHGEH
VARVSLVVQMGSQPQVQVSPQNIQVHEGDTLRMYCRATGSPTPRLSWLKNGGLLPAQVSL
VHVCGACTVPRLPCSLSGITLLFGFDFLAPPCLTLSVHQAIPSHGFHQFKSNSLDVLHRR
IEELQVCPSVCLCRLLAVRHSPCLHSLSTKCMIGRVSHLFEPMSLWLVDRRRSSGPGRPV
LIIREGIKALQRYMGTGVDGGSPPLSLPSCPTRSGSGLSIGSVGIPDRSAPLQPCDRGLG
GLVSSASESRCDVSAFPRGRRALTCNRAEILAERAGAKQLCPPTPHSHPSTGSSPLVVPE
GPQVLVARLSAILRELAGVPTAPSQTSGEHTVSAGSMGRYGPLAPKASIPKTSPCQRKPG
ATPGKSESNSSKLSALTHFPPCLAEITERSLSACFRQARMDRTDIGTLLIPDVQLSDSGT
YMCVGSNSIGSNSAPVKVTVLKGEVPNTVNRFPPFRKYTKGSRISLEPLSTGPSMTSIFH
FSNPSPPVTHIGSGRRLTLFGKILCLCCVCVCAADQSFPAVSIQPSTADIQEGQSLELNC
VAPGNPPPKVSWWRASGLSSNHQVLGNQLRILSATAEDSGEYTCRVEGTMETPHLVVTRP
PSPCPSPHRLHVRAQKKKKKKNERCSCYVCGAVRLGLGSELTHTEASSMPVDGPLLSARW
RLHRRNVVFSCAFRQKAQSAAADPRSHPHALLPGAAPPSAAGLQSPIIAIEPHSAVVRVG
ETATFRCRIYSGAQPVRLEWKVANNQHLPDNVKVSRDGSVITIVNVRPENHGSYRCVASN
PFGITHTVVSVIVKDSPVAVVTPAGPVRVRLGQPINLECQASGEPRPSVSWHRLDSNRKT
LLTSPVPMETNAVMQVKILAARPEDSGTYVCTARSGDSSTETKVEVIVEGKPTASVPEPQ
MVVVEGRTATLRCHAHGFPAPVITWSKLRSPLPWRHKVVNSSLVLPSVGRQDSGEYICRA
SNRMGASQATIKLDVETLPYATLLPDNVAVRAGEVIRLQCLAHGTPPLTYTWTRLDGRLP
SRAVVNGGDLQINLAAADDAGSYKCVASNSVGSSEVIAKVAVRSENVAVFAAPLAVRVSP
QVEVRAQGSAVEFTCSAAGGLDTTIEWLKEGGALPPNHHVKDGVLRIEDLEQSNEGVYIC
RASSSFGQAQDTARLTIQALPKVMINVRTSVQTVMIGNSVEFECQALGEPEPTVQWSKVG
GSLPAHIMVKGGMLRIEQVTEVDAGQYRCTATNDVGSVQSQVVLNVQSLPQISALPEKKE
VTVGSDAVLPCVASGYPAPEIRWSKLEGELPSKCLQEVNVLTVPRVAHEDSGTYVCTASN
KQGKVEAFTRLQVHERVMPYFAQEPLSYLTLPTIRNAYKTFNIKVNFRPDNGDEGMILYN
GQKRTTGADFISLGLVGGRLEFRFDVGSGMATIRDPNPVKLGEFHTVELYRNHTLGYIVV
DGGEPINGSSQGKFQGLDLNEELHVGGYPNYTLLAKTAGIKTGFVGCIRQLVIQGEEVIF
KDLHRNSTGVSNCPTCKDRPCQNGGACEDSETSLYRCSCPRGFTGSNCQHHSSLHCHSEA
CGPDATCINRANGLGYDCRCHLGKFGNKCMEGELVTTPLFDGDQSYIAYPPLTNIHDDLR
VELEFKPLERDGLMFFCGGKKMKVEDFVSISMVEGHVEFRYELGTGQAVLLSLEPVSLGQ
WHKVVAERNKRAGHLKVDQGPTQRIFSPGKAQGLNIHTPMYLGGVPNMDLLPKPANISQM
FQGCVGEVSINNKKLDLSYSFTESRAIRTCVDGSPCDRRPCLNGGHCLSSAEYEYQCLCQ
DGFEGERCEVLKDVCQSNRQCQNGGICVEGLCVCLPAYTGPTCGEGRVPSVSRATWESAA
SEANDSPYQFEAHFHKDGYISLPKSVFPRSTPDSPETIELEISTGFPDGLILWQGVELGE
HGRGKDFISLGLQNGHLLFSYQLGSGEAHILSREAVNDGRWHKVTAVRTGKDGYVQIDGG
AAVHGQSRGRSIMVNTKGSVYLGGAPDMVAMTGGKFSAGLSGCVRNLVLMNGGQPAQTVD
LQAHAASGFNVQPCSS
Download sequence
Identical sequences H3D4F8
99883.ENSTNIP00000015396 ENSTNIP00000015396 ENSTNIP00000015395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]