SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015410 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015410
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000014
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 2 Region: 66-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000011
Family Fibronectin type I module 0.084
Further Details:      
 
Domain Number 3 Region: 176-222
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000628
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015410   Gene: ENSTNIG00000012439   Transcript: ENSTNIT00000015615
Sequence length 312
Comment pep:novel chromosome:TETRAODON8:9:10078029:10079876:-1 gene:ENSTNIG00000012439 transcript:ENSTNIT00000015615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLCDSPCACPSAAPRCPPGVALVPDGCRCCSVCARQRGEPCTDRFPCDPHRGLRCDYSAS
FPGEPGECVGEDELGCELNGVTYHEGQEFQPSCDTLCRCRGGGVTCVPACPLHGRRPTPD
CPNPQHVRLPGECCKKWVCESLENTVFQDAITAMRRTRLLPSLPQHHPLNTPVPPGPACP
EKSTQWSPCSQSCGAGVSTRVSNQNPACKLQMETRLCKVRPCYSVQPAPKPAAGQQGRCE
ASDASPGPIRLLHQGCVSTRAFRLRYCGGCTDWRCCVPHQTSTAEVTFRCLTGVLIRRPV
MMIHSCVCGDTC
Download sequence
Identical sequences H3D4H2
99883.ENSTNIP00000015410 ENSTNIP00000015410 ENSTNIP00000015410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]