SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015536 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015536
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily EF-hand 7.05e-38
Family Calmodulin-like 0.000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015536   Gene: ENSTNIG00000012567   Transcript: ENSTNIT00000015742
Sequence length 177
Comment pep:novel chromosome:TETRAODON8:9:8098287:8099425:-1 gene:ENSTNIG00000012567 transcript:ENSTNIT00000015742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEWYKKFVIECPSGTLFMHEFKSFFGVTENKEAADYIENMFRAFDKNGDNTIDFLEYVAA
LNLVLRGKLEHKLKWTFKMYDKDGSGCIDKTELLEIVESIYRLKKACHGELDEDCILLTP
DQVVDRIFELVDENGDGELSLDEFIDGARRDKWVMKMLQMDVNPGDWLNDRRRSANF
Download sequence
Identical sequences Q4S5Q9
ENSTNIP00000015536 99883.ENSTNIP00000015536 ENSTNIP00000015536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]