SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015551 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015551
Domain Number 1 Region: 807-914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-22
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 2 Region: 289-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 4-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 251-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 665-802
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 138-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000033
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015551
Domain Number - Region: 619-710
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00199
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015551   Gene: ENSTNIG00000012581   Transcript: ENSTNIT00000015757
Sequence length 992
Comment pep:novel chromosome:TETRAODON8:9:7745336:7784364:-1 gene:ENSTNIG00000012581 transcript:ENSTNIT00000015757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDVDECAEGLDNCSIDAICQNTVKSYKCICKSGYKGDGKHCEDVDECVTEYNGGCVHECI
NIPGNYRCTCYDGFRLAHDGHNCLDVDECSEGNGGCQQICVNMMGSYECRCREGFLLSDN
QHTCIQRPKVQMEGTKEGPTCMDKNHGCAHICRETQKGGIACECRPGFQLTRNMKDCKLT
CNYGNGGCQHICEETDHGPKCSCHMKFVLHSDGKTCVVERSHAQSSRLSASSNAINEFDT
MFCRRWPSETCAVNNGGCDSTCHDSVTGVRCSCPVGFTLQPDRKTCKDIDECRLNNGGCD
HVCRNTVGSFECSCKKGYKLLTNERTCQDIDECSFDRTCDHFCVNSAGSFQCLCDKGYVL
YGLAHCGDIDECSINRGGCKYGCINSLGSYECTCPPGYKLHWNRKDCVELVKCPPGLVAP
KATLTCNKTGKKESCSLTCASKAHYLAESDNSYSVSCGIPILRGKSPARLNSSTSQGCIE
TLAPPVKQTASFKIKNAKCHLHPKLSGRTEDRGSAQPCSNCLVTFVNLKCDSSKKAKGRR
ARNPSNKEVTRITLELEAEVKPGDTTGSCNLSCLRQRMEKQVKTYIKALKKSINQERFLI
RVAGLEYEVAQKLPQAAPVQENCGPGWERDGSRCVRCSSGSYYHGEQERCVLCPPGTFQE
KEGQLACDLCPGSDGHGPVGARNISSCAGQCPMGYFSGDGFKPCQPCPQGAYQPDLGRTL
CFPCGGGLSTKREGASSFHDCEVKVQCSPGHYYNTTVHRCIRCPVGTYQTEFRQNYCISC
PGNTTTDFDGATSVSQCKNRQCGGEMGEFMGYIESPNYPGNYPANVECIWNINPPSKRKI
LIVVPEIFLPSEDECGDVLVMRKNWSATSITTYETCQTYERPIAFTARSRRLWINFKSNE
VNSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKTLFDVLAHPHNY
FKYTTRESNEMLPRSFIRLISSKVSAFLRPYK
Download sequence
Identical sequences H3D4W2
ENSTNIP00000015551 ENSTNIP00000015551 99883.ENSTNIP00000015551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]