SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015603 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015603
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-41
Family Galectin (animal S-lectin) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015603   Gene: ENSTNIG00000012631   Transcript: ENSTNIT00000015810
Sequence length 136
Comment pep:novel chromosome:TETRAODON8:3:8761826:8764724:1 gene:ENSTNIG00000012631 transcript:ENSTNIT00000015810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQSGLIVKNMSFKVGQTMTIVGVPSPDASNFAINICQNEQEITMHFNARFNAHGDENKV
VCNSYQGGNWCGEVREGGFPFRQGEEFQLTIEFTPAEFLVKLSDGSVIHFPNRVGAEKYA
LLNFDGDVRIKGIRIE
Download sequence
Identical sequences H3D514
ENSTNIP00000015603 ENSTNIP00000015603 99883.ENSTNIP00000015603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]