SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015607 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015607
Domain Number 1 Region: 329-465
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-33
Family Netrin-like domain (NTR/C345C module) 0.015
Further Details:      
 
Domain Number 2 Region: 108-203
Classification Level Classification E-value
Superfamily Immunoglobulin 5.63e-21
Family I set domains 0.0084
Further Details:      
 
Domain Number 3 Region: 282-337
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 4 Region: 218-277
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000213
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.021
Further Details:      
 
Domain Number 5 Region: 1-47
Classification Level Classification E-value
Superfamily Elafin-like 0.00000183
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015607   Gene: ENSTNIG00000012635   Transcript: ENSTNIT00000015814
Sequence length 471
Comment pep:novel chromosome:TETRAODON8:3:8865213:8867481:1 gene:ENSTNIG00000012635 transcript:ENSTNIT00000015814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAGMCPNELNPNLWVDAMSTCMRECESDQECESFEKCCPNVCGNKSCVAARYIDKCYLDA
EACSKGISISEVACRYHLTWPNTSPMPPGTTLHPTTALQTTLPADVQLPAIHTGPAQQAV
FVGETASFLCEVSGKPRPEITWEKQLKGKENTVMRPNHVRGNIVVTNIGQLVIYNAQLHD
AGIYTCTARNVGGGVSSHFPLAVIRREAKGKGVANHTDLPFPAEECLKGPDTDDCGEESI
SWYYESKRNSCFTFTYSQCNKNRNHFHTYEACMLACGGELAAPCSLPSLQGPCKAYEPRW
AYNSGLKKCQSFVYGGCGGNENNFESREACEEMCPFPKNHHCKACKPRGKMVNSFCKSDF
VILGRVTELTEEQESGHALVTVEEILKDEKMGLRFFGKEPLEVTLLNMDWNCPCPNITTA
NEQLVVMGDVHNGMAVLQPDSFVTLSSARKIRKLREIVQKKTCDFLKDISG
Download sequence
Identical sequences H3D518
ENSTNIP00000015607 99883.ENSTNIP00000015607 ENSTNIP00000015607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]