SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015647 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015647
Domain Number 1 Region: 433-548
Classification Level Classification E-value
Superfamily TIMP-like 1.41e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.016
Further Details:      
 
Domain Number 2 Region: 305-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000276
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 236-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family Laminin-type module 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015647
Domain Number - Region: 72-129
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000936
Family APC10-like 0.084
Further Details:      
 
Domain Number - Region: 367-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 113-180
Classification Level Classification E-value
Superfamily Sialidases 0.0824
Family Sialidases (neuraminidases) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015647   Gene: ENSTNIG00000012673   Transcript: ENSTNIT00000015854
Sequence length 548
Comment pep:novel chromosome:TETRAODON8:19:1524757:1536766:1 gene:ENSTNIG00000012673 transcript:ENSTNIT00000015854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RACNPRMGNLALGRQVLTQTVCGNNGTELYCSYSDPDANLACGAARCAKCNAGLPLLAHL
PGAMSDSSFRHPNTWWQSAQGAEAEMVQLDLEAEFYFTHLILVFRSPRPAAMTLERSTDF
GRTWKMLQYYAKNCRAAFGFLEGGKGVGRDGATCTSKYSGAYPCNRGEVIYRSLPKWESL
DPFGNEGQQQLKVTNIRIRLLRHQPCPCQAKDRAATHEPPPTQHFAIYDLIVKGSCSCNG
HAEQCVPALGYQPIRDRTNHVVHGKCVCRHNTAGDHCERCAPLHNDRPWQPADGLTGAPH
ECQKCKCNGHAQSCHFDWTAWRESGQRSGGVCDCLHNTEGRQCQKCRAGFYRDPRRPHTA
PDSCKPCSCHPLGSLPLHPDGSVCDPSNGNCVCKPGVGGAHVRQSAVAFLGRHEEHTSCI
KILICLRLPPAEKCECKEQALINSKLFCTMNYAYVLKVKVLSAHDKGSHAEVEVKVQKVL
SQNTKVKIQRGRATLYPESWTARGCTCPILNPGGEYLVAGHSDRKQGRLLVNMKSFVKPW
KASLGRKV
Download sequence
Identical sequences H3D558
99883.ENSTNIP00000015647 ENSTNIP00000015647 ENSTNIP00000015647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]