SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016017 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016017
Domain Number 1 Region: 103-333
Classification Level Classification E-value
Superfamily L domain-like 1.93e-47
Family Ngr ectodomain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 398-650
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.83e-32
Family Rhodopsin-like 0.0016
Further Details:      
 
Domain Number 3 Region: 25-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016017   Gene: ENSTNIG00000013038   Transcript: ENSTNIT00000016228
Sequence length 657
Comment pep:novel chromosome:TETRAODON8:20:2233860:2254999:1 gene:ENSTNIG00000013038 transcript:ENSTNIT00000016228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INSDNSFFVILSASLTGLNISEEATSCPLGYFPCGNLSVCLPQLMHCNGINDCGNQADEE
NCGDNNGWPHLFDKYFAAQHVVMTAEFVWDLDVPSPVLGAVPERCLCRDLELDCDGGQLP
DIPVVAVNVTMMSLQRNLLQELKAKIFFRYHNLQKLYLQHNNIHSVNPDAFRGLYNLTRL
YLSYNRISVLMPGVFQDLHKLEWLILENNDIHQVSPMTFSGLNSLVLLVLLNNSLTKLDD
ICREMPRLNWLDLEGNLIETIGNVSFHSCSMLTVLVLQKNRISHINEQAFSVLHRLGELD
LSSNRLVAIPPNLFLLLEDLLQLNISYNPINKIRVICFLSSKKRLSIEGIEIENIQRRMF
EPLKHLTHIYFKKFQYCGYAPHVRSCKPNTDGISSFENLLANIVLRVFVWVVSATTCFSN
IFVICMRAYIRSENKLHAMCIISLCCADGLMGIYLFMIGAYDLKYRGEYNRHAQAWMDSI
QCQVIGSLAMLSTEVSVLLLTYLTLEKYICIVYPFHLTPGRRRTVSILLGIWVFGFIVAF
LPLACKEPFRNFYGTNGVCFPLHSEQPETLWAYVYSIVIFLGLNLVAFLIIVFSYASMFY
NIQRTGTQTTKYSNHIKNEVTIAKRFFSIVITDSLCWIPIFILKILSLLHVEIPGTV
Download sequence
Identical sequences H3D677
ENSTNIP00000016017 99883.ENSTNIP00000016017 ENSTNIP00000016017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]