SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016020 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016020
Domain Number 1 Region: 235-401,702-919,974-1005
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-102
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 381-470
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-18
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 3 Region: 121-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000166
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 612-691
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000672
Family Ras-binding domain, RBD 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016020   Gene: ENSTNIG00000013041   Transcript: ENSTNIT00000016231
Sequence length 1414
Comment pep:novel chromosome:TETRAODON8:20:2302915:2322203:1 gene:ENSTNIG00000013041 transcript:ENSTNIT00000016231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLAPSDSNGVPSQQDKPPLPADFSRLHLADGLHPQVTHVSSSHSGCSITSDSGSSSLS
DIYQATENEPGDMDLSGLPETAVDSEEDDDEEDIERSSDPLMSRDIVRDCLEKDPMDRTD
DDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGS
VEVTYPEGRTDILCMGNSFGVSPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEK
NMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTYIEDFLL
TYRTFLSSPMVVGKKLLEWFHDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTHFLEEFENN
LEREKMCGHLRLLNIACAAKAKPRLVTLTKPARDSPLAFSLLGGQEKGFPIFIDAVEPGS
KAAEVSLKRGDQILEVNGQNFENVQLTKANEILKNNTHLSITVKTNLLVFKELLTRPEHD
HDLDAEEEHDRKNSAPHLPKIGDIKKASRYSIPDLAVDVEQVMGLEKASKKAKTNTVGGR
NKLKKIFDKTLTSILPPKPYNDVCVGQSQDDSIVGMKQSKQIPQPLPVSGNLSSAGSNYS
CVCDCPDMTDQVLRVFKADQQSRYIMIGKDTTAKEVVAQAIREFALTAAADAYSLCEVSV
TPEGVIKQRRLPDQLSKLADRIQLSGRYYLKSNMETETLCSDEDAQDLLRESQISLLHLS
TVEVATPLSMRAFELFPIEPTEYIDDLFKLRSKSSSSSLKRFEEAINHETFWVATEVTRE
PNQLKRMKTVKHFIKIALHCRECKNFSSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFG
DLQDLFDPSRNMAKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLR
MIAKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSANAAVLDVTQTGGHKKRVRR
SSFLNAKKLYEDAQMARKVKQYLSKLSLETNEDSLQTLSLQCEPSISTLPKNAGGKRPDT
SPVVSRAASQQRGQLAKGNQALQVPAVALYPSRKKVPVKDLPPFGTSSPQSLKKILSLSE
EGNERHRRQPEDTMSNASSQLSSPPTSPQSSPKKGYTRMGDANSDSGHSEISSRSSLVSN
SSFDMVQDERRLRHSGGSRLERRATTDPDQYSLGSYSSMQDCRGIYTGCPTVLSSPSSEE
LTQDQGDRVSLDAADSGRGSWTSCSSGSHDNIQTMQQGRSWETLAFGGGGGGIGGLPPGG
PDSLLGGSAALWAAQARGSWASASSSSSSAAYWGEDSEGDTGTIKRRGGKDINADPETSS
ITSTGSEEAKQLGRPSPSPITAGGKGLLSRKESRYREHRPRAPGYTALSISDLGDGHQHA
STVPASTATHTGRRPPDYTTALQRSRMVTQSPDS
Download sequence
Identical sequences H3D680
99883.ENSTNIP00000016020 ENSTNIP00000016020 ENSTNIP00000016020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]