SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016021 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016021
Domain Number 1 Region: 283-380
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 447-732
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 7.32e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.035
Further Details:      
 
Domain Number 3 Region: 27-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000721
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 206-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000184
Family I set domains 0.069
Further Details:      
 
Domain Number 5 Region: 124-201
Classification Level Classification E-value
Superfamily EF-hand 0.000000000442
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016021   Gene: ENSTNIG00000013042   Transcript: ENSTNIT00000016232
Sequence length 796
Comment pep:novel chromosome:TETRAODON8:20:2358105:2418783:-1 gene:ENSTNIG00000013042 transcript:ENSTNIT00000016232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLMGHSRYPGLCEHKYCGLGQHCVVNHETGQGECKCLDHCKPHYKPVCGSDRKLYQNHCE
LHRASCLKGYRITILHSEECFYKEDNCRLAEYRRLKTTILDLYDKRYMGSNSHSAHKDNM
AARKQLVEVMFKHFDADNSGRVDAHELSQLKVIKQEGLSKDVFECTLFDLLKYNDVNDDE
HLTKEEFYTAFEVGDYSLVVFCKVAVITITQXSSAVLTCAIVGQARPPILWKRNNHYLNS
LNLEDINDFGDDGSLYITKVTTTHMGNYTCHADGYEQLFQTHTLQVNVPPVIQVYPESQA
REPGVTASLRCHAEGIPSPQLTWLKNGMDITPKLSKQLTLQANGSEVHISNVHFEDTGAY
TCIARNEAGVDEDISSLFVEDSARKTLANILWREERLGIGNMFYVFYEDGIKVIQPVACE
IQRHIKPSEKLLALQEEVCPTSPGEEVQRCVWSSAVNVKDKFIYVTQPTLDRVLIVDITS
QKAVQTVSTDPYPVKLHYDRSHDQVWLLSWGDMERNFPTLQVINQASGRVSHHTVHTQPV
GRHFDRVDDFFIPASSLIINHIRFGLILHQNEPIFHKIDLETTSYVKNISLREYNCIPKS
VAYTHLGGYYFVNCKPDSTGATQPQLILDSVTDTIIGQNGDVTGTPYVSPDGHYLVTVDD
RDGLMRIQIISERGKIQAPFDIHTNLHLSDLAFQRSFTELHQYNIFGSSGRQTDVLFVEL
GTGKVKMIKSLKEATRSYEWPWSNKNRVMVSSGLFGQYLVTPSRESLFILDGRLNKLNCE
ITDVLKGNVVVWVGES
Download sequence
Identical sequences H3D681
99883.ENSTNIP00000016021 ENSTNIP00000016021 ENSTNIP00000016021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]