SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016130 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016130
Domain Number 1 Region: 224-425
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.35e-45
Family Reprolysin-like 0.0025
Further Details:      
 
Domain Number 2 Region: 519-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000262
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 936-986
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 874-933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 813-871
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000112
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016130   Gene: ENSTNIG00000013148   Transcript: ENSTNIT00000016341
Sequence length 1065
Comment pep:novel chromosome:TETRAODON8:2_random:1024501:1055597:-1 gene:ENSTNIG00000013148 transcript:ENSTNIT00000016341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKLSEYGLIVPFSTDSRGRYLSHVLSAESGSKGEDAEGAESDGATALGSRRKRVARSVSE
MPKVTSSQRLFFNVTVFGKELHLRLRANRRLVAPGAFVEWQEDFVEKAKERIHGDCVFTG
DVSDMPEASVAISNCDGLSGLIRTDNGEFFIEPLEKGQQDVEVKGRVHVVYRRLAHQKGD
GPGKAGPPQFADFGIANLPTTLDLLEHKLSESERKRRHAKTDDYNIEVLLAVDDSVVRFH
GKEHVQNYVLTLMNIVSLIFHDLSXGQHQHCLVRMIMVGYRQSISLIERGNPSRSLEQVC
RWANTQQRRDPEHAEYHDHAIFLTRQDFGPAGMQGYAPVTGMCHPLRSCTLNHEDGFSSA
FVVAHETGHVLGMEHDGQGNRCADETSMGSIMAPLVQAAFHRYHWSRCSKQELNRYIHSY
DCLLDDPFEHKWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTYDPCKQLWCSHPDNQ
YFCKTKKGPPVDGTECAPGKWCFKGHCIWRSSQEPQGHDGSWGSWSKFGSCSRTCGGGVR
SRSRQCNNPPPAYGGRDCPGSSFDYQMCNTEECAGPYEDFRAQQCIQRSNKYHNNVKHTW
IPYEHPDEARKCELSCKSKETGEVVFMNQVMHDGTRCSYSDPFSVCARGECLHVGCDKEV
GSYKEEDKCGVCEGDNSHCRTVKLTLTKTPKKNGMFKMFDIPMGARHIVIEENETSPHII
AVKNQVTGNFILNAKSEDAETKTFIENGLLWEYSKDADKETLKTSGPLHEGIVVLVIPQE
EDTKISLTYKYIIHEDLLPLITNNNVLLAELDTYEWALKSWSQCSKPCGGGVQYTKYGCR
RKSDNRLVHRNFCESGKKPKPIRKRCNVQDCSPPVWVVEQWSACSKTCGKLGYQTRVVQC
MQAQHNGTNKPVHSKHCTEERPDTRRACNQTLCPAQWRTGAWSQCSVTCGEGIQQRQVVC
KASDNTAAECEGEKPETIIICKLTPCPGQNTGTMQNSTSSVEAMHQRAPDNPVQKISSNE
PCLGDKSIFCQMEVLARYCSIPGYNKLCCESCNKKPVNLKRTRDG
Download sequence
Identical sequences H3D6J0
ENSTNIP00000016130 ENSTNIP00000016130 99883.ENSTNIP00000016130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]